Overview

  • Product nameAnti-ZNF8 antibody
    See all ZNF8 primary antibodies
  • Description
    Rabbit polyclonal to ZNF8
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within N terminal amino acids 36 - 85 (

    QEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELWV

    ) of Human ZNF8 (NP_066575)

  • Positive control
    • THP-1 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab90734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Tissue specificityUbiquitously present in many human cell lines of different embryological derivation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HF.18 antibody
    • Zfp128 antibody
    • Zinc finger protein 272 antibody
    • Zinc finger protein 8 (clone HF.18) antibody
    • Zinc finger protein 8 antibody
    • Zinc finger protein HF.18 antibody
    • ZNF 8 antibody
    • ZNF8 antibody
    • ZNF8_HUMAN antibody
    see all

Anti-ZNF8 antibody images

  • Anti-ZNF8 antibody (ab90734) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 65 kDa

References for Anti-ZNF8 antibody (ab90734)

ab90734 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"