Anti-ZSWIM7 antibody - C-terminal (ab185506)

Overview

  • Product name
    Anti-ZSWIM7 antibody - C-terminal
    See all ZSWIM7 primary antibodies
  • Description
    Rabbit polyclonal to ZSWIM7 - C-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZSWIM7 aa 78-140 (C terminal).
    Sequence:

    CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQ LTDILLMEKKQEA


    Database link: Q19AV6

  • Positive control
    • Human colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Involved in early stages of the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents.
  • Sequence similarities
    Belongs to the SWS1 family.
    Contains 1 SWIM-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • SWIM domain-containing and Srs2-interacting protein 1 homolog antibody
    • SWIM domain-containing Srs2-interacting protein 1 antibody
    • SWIM-type zinc finger domain-containing protein 7 antibody
    • SWS1 antibody
    • Zinc finger SWIM domain-containing protein 7 antibody
    • Zinc finger, SWIM-type containing 7 antibody
    • zswim7 antibody
    • ZSWM7_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling ZSWIM7 with ab185506 at 1/500 dilution.

References

ab185506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up