Overview

  • Product nameAnti-ZWINT antibody
    See all ZWINT primary antibodies
  • Description
    Rabbit polyclonal to ZWINT
  • Tested applicationsSuitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque Monkey
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 225-277 (

    PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP

    ) of Human ZWINT (NP_008988.2)

  • Positive control
    • Human testis tissue. HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab84367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500. Fix with PFA do not fix with acetone.
IHC-P 1/100 - 1/500.

Target

  • FunctionPart of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
  • Cellular localizationNucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase.
  • Information by UniProt
  • Database links
  • Alternative names
    • Human ZW10 interacting protein 1 antibody
    • HZwint 1 antibody
    • HZwint1 antibody
    • KNTC 2 AP antibody
    • KNTC2AP antibody
    • MGC 117174 antibody
    • MGC117174 antibody
    • ZW10 interacting kinetochore protein antibody
    • ZW10 interacting protein 1 antibody
    • ZW10 interactor antibody
    • ZW10 interactor, kinetochore protein antibody
    • ZW10-interacting protein 1 antibody
    • ZWINT 1 antibody
    • ZWINT antibody
    • Zwint-1 antibody
    • ZWINT_HUMAN antibody
    • ZWINT1 antibody
    see all

Anti-ZWINT antibody images

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human testis tissue using  ab84367 at 1/250, followed by DAB staining.

  • ab84367 at 1/250 dillution staining ZWINT in NBF-fixed asynchronous human Hela cells by Immunocytochemistry / Immunofluorescence.

References for Anti-ZWINT antibody (ab84367)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab84367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"