Overview

  • Product name
    Anti-ZYG11A antibody - C-terminal
  • Description
    Rabbit polyclonal to ZYG11A - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human ZYG11A aa 500-549 (C terminal). The exact sequence is proprietary. (NP_001004339).
    Sequence:

    PEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPA


    Database link: Q6WRX3

  • Positive control
    • Hela whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa.

Target

Images

  • Anti-ZYG11A antibody - C-terminal (ab177696) at 1 µg/ml + Hela whole cell lysate at 10 µg

    Predicted band size: 85 kDa

References

This product has been referenced in:
  • Wang X  et al. ZYG11A serves as an oncogene in non-small cell lung cancer and influences CCNE1 expression. Oncotarget 7:8029-42 (2016). WB . Read more (PubMed: 26771237) »

See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Liver)
Antigen retrieval step
Other
Permeabilization
No
Specification
Liver
Blocking step
Step1: 3%H2O2/ Step2: Proteinblock 1 from ZytoChem-Plus HRP Polymer-Kit as blocking agent for 5 minute(s) · Concentration: 0% · Temperature: 20°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Feb 27 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up