
  • Product name
  • Description
    Rabbit polyclonal to ZZZ3
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 577-626 (EREFKNRKRHTRRVKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSD G) of Human ZZZ3, AAH35079

  • Positive control
    • Jurkat cell lysate.



Our Abpromise guarantee covers the use of ab81185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/12500.


  • Function
    Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Sequence similarities
    Contains 1 HTH myb-type DNA-binding domain.
    Contains 1 ZZ-type zinc finger.
  • Post-translational
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • ATAC component 1 homolog antibody
    • ATAC1 antibody
    • DKFZp313N0119 antibody
    • DKFZp564I052 antibody
    • FLJ10362 antibody
    • Zinc finger ZZ domain containing 3 antibody
    • Zinc finger ZZ type containing 3 antibody
    • ZZ type zinc finger containing protein 3 antibody
    • ZZ-type zinc finger-containing protein 3 antibody
    • ZZZ 3 antibody
    • ZZZ3 antibody
    • ZZZ3_HUMAN antibody
    see all

Anti-ZZZ3 antibody images

  • Anti-ZZZ3 antibody (ab81185) at 1 µg/ml + Jurkat cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 48 kDa
    Observed band size : 48 kDa
    Additional bands at : <40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZZZ3 antibody (ab81185)

ab81185 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81185.
Please use the links above to contact us or submit feedback about this product.


Sign up