Anti-12 Lipoxygenase/ALOX12 antibody (ab167372)
Key features and details
- Mouse polyclonal to 12 Lipoxygenase/ALOX12
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-12 Lipoxygenase/ALOX12 antibody
See all 12 Lipoxygenase/ALOX12 primary antibodies -
Description
Mouse polyclonal to 12 Lipoxygenase/ALOX12 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human 12 Lipoxygenase/ALOX12 aa 1-663.
Sequence:MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFD HDVAEDLGLLQFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWV QGEDILSLPEGTARLPGDNALDMFQKHREKELKDRQQIYCWATWKEGLPL TIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLSSWNCL EDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSR LVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNS DFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEIN TRARTQLISDGGIFDKAVSTGGGGHVQLLRRAAAQLTYCSLCPPDDLADR GLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCR EITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDW YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYE YLKPSCIENSVTI
Database link: NP_000688 -
Positive control
- 12 Lipoxygenase/ALOX12 transfected 293T cell lysate, HeLa cells.
-
General notes
This product was previously labelled as 12 Lipoxygenase.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.40
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab167372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa. | |
ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
Oxygenase and 14,15-leukotriene A4 synthase activity. -
Pathway
Lipid metabolism; leukotriene D4 biosynthesis. -
Sequence similarities
Belongs to the lipoxygenase family.
Contains 1 lipoxygenase domain.
Contains 1 PLAT domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 239 Human
- Omim: 152391 Human
- SwissProt: P18054 Human
- Unigene: 654431 Human
-
Alternative names
- 12 LOX antibody
- 12(S) lipoxygenase antibody
- 12-lipoxygenase antibody
see all
Images
-
All lanes : Anti-12 Lipoxygenase/ALOX12 antibody (ab167372) at 1 µg/ml
Lane 1 : 12 Lipoxygenase/ALOX12 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 76 kDa -
Immunofluorescence analysis of HeLa cells labeling 12 Lipoxygenase/ALOX12 with ab167372 at 10µg/ml
Protocols
Datasheets and documents
References (2)
ab167372 has been referenced in 2 publications.
- Zhang Q et al. The SP1-12LOX axis promotes chemoresistance and metastasis of ovarian cancer. Mol Med 26:39 (2020). PubMed: 32375633
- Kim JY et al. Promoter methylation changes in ALOX12 and AIRE1: novel epigenetic markers for atherosclerosis. Clin Epigenetics 12:66 (2020). PubMed: 32398127