Overview

  • Product name

    Anti-12 Lipoxygenase/ALOX12 antibody - C-terminal
    See all 12 Lipoxygenase/ALOX12 primary antibodies
  • Description

    Rabbit polyclonal to 12 Lipoxygenase/ALOX12 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human 12 Lipoxygenase/ALOX12 aa 618-650 (C terminal) conjugated to keyhole limpet haemocyanin. NCBI Accession No. NP_000688.2.
    Sequence:

    PKPKAVLNQFRTDLEKLEKEITARNEQLDWPYE


    Database link: P18054

  • Positive control

    • K562 cell lysate; Human heart tisue; A549 and K562 cells.
  • General notes

     This product was previously labelled as 12 Lipoxygenase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab211506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 76 kDa.
Flow Cyt 1/10 - 1/50.
ICC/IF 1/10 - 1/50.
IHC-P 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Oxygenase and 14,15-leukotriene A4 synthase activity.
  • Pathway

    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities

    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 12 LOX antibody
    • 12(S) lipoxygenase antibody
    • 12-lipoxygenase antibody
    • 12LO antibody
    • 12S LOX antibody
    • 12S-lipoxygenase antibody
    • 12S-LOX antibody
    • 12S-type antibody
    • Alox12 antibody
    • Arachidonate 12 lipoxygenase antibody
    • Arachidonate 12 lipoxygenase, 12S type antibody
    • Arachidonate 12-lipoxygenase antibody
    • Arachidonate 12-oxidoreductase antibody
    • Lipoxin synthase 12-LO antibody
    • LOG12 antibody
    • LOX12_HUMAN antibody
    • P-12LO antibody
    • Platelet 12-LOX antibody
    • Platelet type lipoxygenase 12 antibody
    • platelet-type 12-lipoxygenase antibody
    • Platelet-type lipoxygenase 12 antibody
    see all

Images

  • Anti-12 Lipoxygenase/ALOX12 antibody - C-terminal (ab211506) at 1/1000 dilution + K562 cell lysate at 35 µg

    Predicted band size: 76 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human heart tissue, labeling 12 Lipoxygenase/ALOX12 using ab211506 at a 1/50 dilution.

  • Immunofluorescence analysis of A549 cells, labeling 12 Lipoxygenase/ALOX12 using ab211506 at a 1/100 dilution. Alexa Fluor 488-conjugated goat anti-rabbit lgG at 1/400 dilution was used as the secondary antibody (green). Cytoplasmic actin was counterstained with Dylight Fluor 554 (red) conjugated Phalloidin (red).

  • Flow Cytometry analysis of K562 cells labeling 12 Lipoxygenase/ALOX12 (bottom histogram), using ab211506 at a 1/10 dilution, and negative control cells (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

References

ab211506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up