Overview

  • Product name

    Anti-14-3-3 alpha + beta antibody
    See all 14-3-3 alpha + beta primary antibodies
  • Description

    Rabbit polyclonal to 14-3-3 alpha + beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Zebrafish
    Predicted to work with: Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human 14-3-3 alpha + beta aa 1-246.
    Sequence:

    MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAY KNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL ELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN


    Database link: P31946

  • Positive control

    • WB: HEK-293T, EC109, HeLa, Raji, HepG2, Jurkat and HT-29 whole cell lysates; Rat brain, liver and lung lysates; mouse liver, brain and lung lysates; Zebrafish lysate. IHC-P: Human kidney, testis and small intestine tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/500.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 28 kDa.

Target

  • Function

    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis.
  • Sequence similarities

    Belongs to the 14-3-3 family.
  • Post-translational
    modifications

    The alpha, brain-specific form differs from the beta form in being phosphorylated.
    Isoform Short contains a N-acetylmethionine at position 1.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14 3 3 alpha antibody
    • 14 3 3 protein beta/alpha antibody
    • 14-3-3 protein beta/alpha antibody
    • 1433B_HUMAN antibody
    • Brain protein 14 3 3 beta isoform antibody
    • GW128 antibody
    • HS 1 antibody
    • KCIP-1 antibody
    • KCIP1 antibody
    • N-terminally processed antibody
    • Protein 1054 antibody
    • Protein kinase C inhibitor protein 1 antibody
    • YWHAA antibody
    • YWHAB antibody
    see all

Images

  • All lanes : Anti-14-3-3 alpha + beta antibody (ab237807) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : EC109 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-14-3-3 alpha + beta antibody (ab237807) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : Mouse brain lysate
    Lane 5 : Rat liver lysate
    Lane 6 : Rat lung lysate
    Lane 7 : Mouse lung lysate
    Lane 8 : Zebrafish lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-14-3-3 alpha + beta antibody (ab237807) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-14-3-3 alpha + beta antibody (ab237807) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 6 : HT-29 (Human colorectal adenocarcinoma cell line) whole cell lysate
    Lane 7 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human kidney tissue stained for 14-3-3 alpha + beta using ab237807 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human testis tissue stained for 14-3-3 alpha + beta using ab237807 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human small intestine tissue stained for 14-3-3 alpha + beta using ab237807 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for 14-3-3 alpha + beta (green) using ab237807 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up