Overview

  • Product name

    Anti-14-3-3 gamma/YWHAG antibody
    See all 14-3-3 gamma/YWHAG primary antibodies
  • Description

    Rabbit polyclonal to 14-3-3 gamma/YWHAG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Xenopus laevis, Orange
  • Immunogen

    Recombinant fragment corresponding to Human 14-3-3 gamma/YWHAG aa 113-194.
    Sequence:

    SETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISK EHMQPTHPIRLGLALNYSVFYYEIQNAPEQAC


    Database link: P61981

  • Positive control

    • WB: Mouse brain lysate; Rat brain lysate; NIH/3T3, A431, K562, U-251 MG, HeLa and Jurkat whole cell lysates; Human placenta lysate. IHC-P: Human ovarian cancer and pancreatic cancer tissues. IP: NIH/3T3 whole cell lysate.
  • General notes

     This product was previously labelled as 14-3-3 gamma

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
IP 1/200 - 1/2000.

Target

  • Function

    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificity

    Highly expressed in brain, skeletal muscle, and heart.
  • Sequence similarities

    Belongs to the 14-3-3 family.
  • Post-translational
    modifications

    Phosphorylated by various PKC isozymes.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14 3 3 gamma antibody
    • 14 3 3 protein gamma antibody
    • 14 3 3 protein gamma subtype antibody
    • 14 3 3gamma antibody
    • 14-3-3 protein gamma antibody
    • 1433G_HUMAN antibody
    • 3 monooxygenase/tryptophan 5 monooxgenase activation protein gamma polypeptide antibody
    • KCIP 1 antibody
    • KCIP-1 antibody
    • KCIP1 antibody
    • N-terminally processed antibody
    • Protein kinase C inhibitor protein 1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein gamma polypeptide antibody
    • Ywhag antibody
    see all

Images

  • All lanes : Anti-14-3-3 gamma/YWHAG antibody (ab237732) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 6 : Human placenta lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-14-3-3 gamma/YWHAG antibody (ab237732) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 4 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 5 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 6 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for 14-3-3 gamma/YWHAG using ab237732 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for 14-3-3 gamma/YWHAG using ab237732 at 1/100 dilution in immunohistochemical analysis.

  • 14-3-3 gamma/YWHAG was immunoprecipitated from 0.5 mg NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate with ab237732 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP in NIH/3T3 whole cell lysate.

    Lane 2: ab237732 IP in NIH/3T3 whole cell lysate.

    Lane 3: NIH/3T3 whole cell lysate 10 μg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab237732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up