Overview

  • Product name

  • Description

    Rabbit polyclonal to 24p3R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human 24p3R aa 1-99.
    Sequence:

    MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASR VATSTDPSCSGFAPPDFNHCLKDWDYNGLPVLTTNAIGQWDLVCDLGWQ


    Database link: Q8WUG5

  • Positive control

    • WB: U-87 MG whole cell lysate. IHC-P: Human cervical cancer tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/500.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis. Also binds iron-free LCN2 (apo-24p3), followed by internalization of apo-24p3 and its association with an intracellular siderophore, leading to iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration and resulting in apoptosis.
  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization

    Cell membrane. Vacuole membrane. Upon LCN2-binding, it is internalized.
  • Information by UniProt
  • Database links

  • Alternative names

    • 24p3 receptor antibody
    • 24p3R antibody
    • BOCT antibody
    • BOIT antibody
    • Brain type organic cation transporter antibody
    • Brain-type organic cation transporter antibody
    • hBOIT antibody
    • Lipocalin-2 receptor antibody
    • Neutrophil gelatinase associated lipocalin receptor antibody
    • Neutrophil gelatinase-associated lipocalin receptor antibody
    • NGAL receptor antibody
    • NgalR antibody
    • NGALR2 antibody
    • NGALR3 antibody
    • OTTHUMP00000082690 antibody
    • OTTHUMP00000082691 antibody
    • Potent brain type organic ion transporter antibody
    • S22AH_HUMAN antibody
    • Slc22a17 antibody
    • Solute carrier family 22 member 17 antibody
    • Solute carrier family 22 organic cation transporter member 17 antibody
    see all

Images

  • Anti-24p3R antibody (ab237539) at 1/500 dilution + U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human cervical cancer tissue stained for 24p3R using ab237539 at 1/100 dilution in immunohistochemical analysis.

  • A549 (Human lung carcinoma cell line) cells stained for 24p3R (green) using ab237539 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up