Overview

  • Product name

    Anti-4-1BBL antibody [CD137L/1547]
    See all 4-1BBL primary antibodies
  • Description

    Mouse monoclonal [CD137L/1547] to 4-1BBL
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human 4-1BBL aa 1-254.
    Sequence:

    MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLA CPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNV LLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELR RVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQ GRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPS PRSE


    Database link: P41273

  • Positive control

    • IHC-P: Human renal cell carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    ab223160 is purified from bioreactor concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    CD137L/1547
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
  • Tissue specificity

    Expressed in brain, placenta, lung, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 1BB L antibody
    • 4 1BB ligand antibody
    • 4 1BBL antibody
    • 4-1BB ligand antibody
    • 4-1BBL antibody
    • Cd137l antibody
    • Cd157l antibody
    • Homolog of mouse 4 1BB L antibody
    • Homolog of mouse 4 1BBL antibody
    • ILA ligand (TNF related) antibody
    • Ly63l antibody
    • Receptor 4 1BB ligand antibody
    • TNF superfamily member 9 antibody
    • TNFL9_HUMAN antibody
    • Tnfsf9 antibody
    • TNLG5A antibody
    • Tumor necrosis factor (ligand) superfamily member 9 antibody
    • Tumor necrosis factor ligand 5A antibody
    • Tumor necrosis factor ligand superfamily member 9 antibody
    • Tumor necrosis factor superfamily member 9 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human renal cell carcinoma tissue stained for 4-1BBL with ab223160 at 2 µg/ml in immunohistochemical analysis.

References

ab223160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up