Overview

  • Product name

    Anti-4E-BP3 antibody
  • Description

    Rabbit polyclonal to 4E-BP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human 4E-BP3 aa 1-100.
    Sequence:

    MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKN SPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI


    Database link: O60516

  • Positive control

    • IHC-P: Human pancreas and adrenal gland tissue.
  • General notes

     This product was previously labelled as EIF4EBP3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    EIF4EBP3 is a member of the eIF4E-binding protein family which regulates eIF4E activity by preventing its assembly into the eIF4F complex.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 4E BP3 antibody
    • 4E-BP3 antibody
    • 4EBP3 antibody
    • eIF4E binding protein 3 antibody
    • Eukaryotic initiation factor 4E binding protein 3 antibody
    • Eukaryotic translation initiation factor 4E binding protein 3 antibody
    • OTTHUMP00000159879 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for 4E-BP3 with ab238500 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for 4E-BP3 with ab238500 at a 1/100 dilution in immunohistochemical analysis.

References

ab238500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up