Overview

  • Product name
  • Description
    Mouse polyclonal to 4E-T
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Baboon, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human 4E-T aa 1-985.
    Sequence:

    MDRRSMGETESGDAFLDLKKPPASKCPHRYTKEELLDIKELPHSKQRPSC LSEKYDSDGVWDPEKWHASLYPASGRSSPVESLKKELDTDRPSLVRRIVD PRERVKEDDLDVVLSPQRRSFGGGCHVTAAVSSRRSGSPLEKDSDGLRLL GGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGD SKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR KRTRRRTASVKEGIVECNGGVAEEDEVEVILAQEPAADQEVPRDAVLPEQ SPGDFDFNEFFNLDKVPCLASMIEDVLGEGSVSASRFSRWFSNPSRSGSR SSSLGSTPHEELERLAGLEQAILSPGQNSGNYFAPIPLEDHAENKVDILE MLQKAKVDLKPLLSSLSANKEKLKESSHSGVVLSVEEVEAGLKGLKVDQQ VKNSTPFMAEHLEETLSAVTNNRQLKKDGDMTAFNKLVSTMKASGTLPSQ PKVSRNLESHLMSPAEIPGQPVPKNILQELLGQPVQRPASSNLLSGLMGS LEPTTSLLGQRAPSPPLSQVFQTRAASADYLRPRIPSPIGFTPGPQQLLG DPFQGMRKPMSPITAQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGK PQVDRTRDGFRNRQQRVTKSPAPVHRGNSSSPAPAASITSMLSPSFTPTS VIRKMYESKEKSKEEPASGKAALGDSKEDTQKASEENLLSSSSVPSADRD SSPTTNSKLSALQRSSCSTPLSQANRYTKEQDYRPKATGRKTPTLASPVP TTPFLRPVHQVPLVPHVPMVRPAHRLHPGLVQRMLAQGVHPQHLPSLLQT GVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQ QLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSS SPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ


    Database link: AAH33028.1

  • Positive control
    • HeLa nuclear extract, Jurkat cell lysate, 4E-T transfected 293T cell line lysate, HeLa cells

Properties

Applications

Our Abpromise guarantee covers the use of ab168098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 108 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism.
  • Tissue specificity
    Widely expressed.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly cytoplasmic. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent manner.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2610509L04Rik antibody
    • 4E T antibody
    • 4E-T antibody
    • 4ET antibody
    • 4ET_HUMAN antibody
    • A930019J01Rik antibody
    • AA410001 antibody
    • AU021239 antibody
    • Clast 4 antibody
    • Clast4 antibody
    • D11Ertd166e antibody
    • eIF4E transporter antibody
    • Eif4enif1 antibody
    • Eukaryotic translation initiation factor 4E nuclear import factor 1 antibody
    • Eukaryotic translation initiation factor 4E transporter antibody
    • FLJ21601 antibody
    • FLJ26551 antibody
    • OTTMUSP00000000698 antibody
    • OTTMUSP00000005193 antibody
    • OTTMUSP00000005194 antibody
    • OTTMUSP00000036075 antibody
    see all

Images

  • Anti-4E-T antibody (ab168098) at 1 µg/ml + HeLa nuclear exract at 50 µg

    Predicted band size: 108 kDa

  • Anti-4E-T antibody (ab168098) at 1 µg/ml + Jurkat cell lysate at 50 µg

    Predicted band size: 108 kDa

  • All lanes : Anti-4E-T antibody (ab168098) at 1 µg/ml

    Lane 1 : 4E-T transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Predicted band size: 108 kDa

  • Immunofluorescent analysis of HeLa cells labeling 4E-T with ab168098 at 10 µg/ml.

References

ab168098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up