Overview

  • Product name

  • Description

    Rabbit polyclonal to 5-HT-2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human 5-HT-2B aa 393-455.
    Sequence:

    RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMY QSPMRLRSSTIQS


    Database link: P41595

  • Positive control

    • ICC/IF: SK-MEL-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior.
  • Tissue specificity

    Expressed in brain. Higher levels of expression are observed in the cerebellum, occipital cortex and frontal cortex.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 HT 2B antibody
    • 5 HT 2B receptor antibody
    • 5 HT(2B) antibody
    • 5 HT2B antibody
    • 5 hydroxytryptamine (serotonin) receptor 2B antibody
    • 5 hydroxytryptamine (serotonin) receptor 2B G protein coupled antibody
    • 5 hydroxytryptamine 2B receptor antibody
    • 5 hydroxytryptamine receptor 2B antibody
    • 5-HT-2B antibody
    • 5-HT2B antibody
    • 5-hydroxytryptamine receptor 2B antibody
    • 5HT(2B) antibody
    • 5HT2B Receptor antibody
    • 5HT2B_HUMAN antibody
    • 5HT2F antibody
    • Htr 2b antibody
    • Htr2b antibody
    • NP75 protein antibody
    • SEROTONIN 5HT2B RECEPTOR antibody
    • Serotonin receptor 2B antibody
    • Stomach fundus serotonin receptor antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells labeling 5-HT-2B with ab221181 at 4 µg/mL (green).

References

ab221181 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up