Overview

  • Product name

    Anti-5-HT-2B antibody - Extracellular domain
    See all 5-HT-2B primary antibodies
  • Description

    Mouse polyclonal to 5-HT-2B - Extracellular domain
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human 5-HT-2B aa 1-56 (extracellular).
    Sequence:

    MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQ GNKLHW


    Database link: P41595

  • Positive control

    • HepG2 cell lysate; Recombinant fragment of 5-HT-2B.

Properties

Applications

Our Abpromise guarantee covers the use of ab194333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 54 kDa.

Target

  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior.
  • Tissue specificity

    Expressed in brain. Higher levels of expression are observed in the cerebellum, occipital cortex and frontal cortex.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 HT 2B antibody
    • 5 HT 2B receptor antibody
    • 5 HT(2B) antibody
    • 5 HT2B antibody
    • 5 hydroxytryptamine (serotonin) receptor 2B antibody
    • 5 hydroxytryptamine (serotonin) receptor 2B G protein coupled antibody
    • 5 hydroxytryptamine 2B receptor antibody
    • 5 hydroxytryptamine receptor 2B antibody
    • 5-HT-2B antibody
    • 5-HT2B antibody
    • 5-hydroxytryptamine receptor 2B antibody
    • 5HT(2B) antibody
    • 5HT2B Receptor antibody
    • 5HT2B_HUMAN antibody
    • 5HT2F antibody
    • Htr 2b antibody
    • Htr2b antibody
    • NP75 protein antibody
    • SEROTONIN 5HT2B RECEPTOR antibody
    • Serotonin receptor 2B antibody
    • Stomach fundus serotonin receptor antibody
    see all

Images

  • Anti-5-HT-2B antibody - Extracellular domain (ab194333) at 1/500 dilution + HepG2 cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 54 kDa

  • Anti-5-HT-2B antibody - Extracellular domain (ab194333) at 1/1000 dilution + Recombinant fragment of 5-HT-2B at 0.2 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 54 kDa

References

ab194333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up