Overview

  • Product name

    Anti-5-oxo-ETE GPCR antibody
    See all 5-oxo-ETE GPCR primary antibodies
  • Description

    Rabbit polyclonal to 5-oxo-ETE GPCR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human 5-oxo-ETE GPCR aa 1-97.
    Sequence:

    MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPM ELHNLSSPSPSLSSSVLPPSFSPSPSSAPSAFTTVGGSSGGPCHPTSSSL VSAFLAP


    Database link: Q8TDS5

  • Positive control

    • WB: K562, HepG2 and HEK-293 cell lysate; Rat lung lysate. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid. Seems to be coupled to the G(i)/G(o), families of heteromeric G proteins.
  • Tissue specificity

    Expressed in various tissues except brain. Expression is more intense in liver, kidney, peripheral leukocyte, lung, and spleen than in other tissues. Highly expressed in eosinophils, neutrophils, and lung macrophages.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 oxo ETE acid G protein coupled receptor 1 antibody
    • 5 oxo ETE G protein coupled receptor antibody
    • 5-oxo-ETE G-protein coupled receptor antibody
    • G protein coupled receptor 170 antibody
    • G protein coupled receptor R527 antibody
    • G protein coupled receptor TG1019 antibody
    • G-protein coupled receptor 170 antibody
    • G-protein coupled receptor R527 antibody
    • G-protein coupled receptor TG1019 antibody
    • GPCR antibody
    • GPR170 antibody
    • OTTHUMP00000158809 antibody
    • OXER1 antibody
    • OXER1_HUMAN antibody
    • Oxoeicosanoid (OXE) receptor 1 antibody
    • Oxoeicosanoid receptor 1 antibody
    • TG1019 antibody
    see all

Images

  • All lanes : Anti-5-oxo-ETE GPCR antibody (ab235059) at 1/500 dilution

    Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow ) cell lysate
    Lane 2 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 4 : Rat lung tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human small intestine tissue stained for 5-oxo-ETE GPCR using ab235059 at 1/100 dilution in immunohistochemical analysis.

References

ab235059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up