Anti-50S ribosomal protein L7/L12 antibody (ab225681)

Overview

  • Product name

    Anti-50S ribosomal protein L7/L12 antibody
  • Description

    Rabbit polyclonal to 50S ribosomal protein L7/L12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Staphylococcus aureus
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Staphylococcus aureus 50S ribosomal protein L7/L12 aa 1-122. (6xHis-SUMO tag at the N-terminal).
    Sequence:

    MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAA AEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEAL PKEEAEKLKEQLEEVGATVELK


    Database link: P66061

  • Positive control

    • WB: Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12 protein with 6xHis-SUMO tag at the N-terminal.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 29 kDa (predicted molecular weight: 13 kDa).

Target

  • Relevance

    Function: Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.
  • Database links

    • Alternative names

      • rplL antibody

    Images

    • All lanes : Anti-50S ribosomal protein L7/L12 antibody (ab225681) at 1/500 dilution

      Lane 1 : Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12 protein with 6xHis-SUMO tag at the N-terminal at 0.08 µg
      Lane 2 : Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12 protein with 6xHis-SUMO tag at the N-terminal at 0.04 µg
      Lane 3 : Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12 protein with 6xHis-SUMO tag at the N-terminal at 0.025 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 13 kDa
      Observed band size: 29 kDa
      why is the actual band size different from the predicted?



      Predicted MWt including 6xHis-SUMO tag: 29 kDa

    References

    ab225681 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab225681.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up