Anti-5HT2A Receptor antibody (ab216959)
Key features and details
- Rabbit polyclonal to 5HT2A Receptor
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-5HT2A Receptor antibody
See all 5HT2A Receptor primary antibodies -
Description
Rabbit polyclonal to 5HT2A Receptor -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human -
Immunogen
Synthetic peptide within Human 5HT2A Receptor aa 40-75 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKN
Database link: P28223 -
Positive control
- Rat brain tissues
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol
Aqueous buffered solution -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab216959 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. When using a fluorescent probe please use a dilution of 1/50 - 1/200. |
|
WB | 1/300. |
Target
-
Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Domain
The PDZ domain-binding motif is involved in the interaction with INADL, CASK, APBA1, DLG1 and DLG4. -
Cellular localization
Cell membrane. Localizes to the post-synaptic thickening of axo-dendritic synapses. - Information by UniProt
-
Database links
- Entrez Gene: 3356 Human
- Entrez Gene: 15558 Mouse
- Entrez Gene: 29595 Rat
- Omim: 182135 Human
- SwissProt: P28223 Human
- SwissProt: P35363 Mouse
- SwissProt: P14842 Rat
- Unigene: 654586 Human
see all -
Alternative names
- 5 HT 2 antibody
- 5 HT 2A antibody
- 5 HT2 receptor antibody
see all
Images
-
Anti-5HT2A Receptor antibody (ab216959) at 1/300 dilution + Mouse cerebellum lysates
Secondary
Conjugated secondary antibody at 1/20000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)
Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)
Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody Goat Anti-Rabbit IgG, Cy3 conjugated, at 1/200 dilution or 40 minutes at 37°C.
Datasheets and documents
References (1)
ab216959 has been referenced in 1 publication.
- Moghaddam RA et al. Evaluation of Isolated Vascular Response to 5HT1A, 5HT1B1D & 5HT2A Receptors Agonist & Antagonist in Chronic Endotoxemic Rats. Drug Res (Stuttg) N/A:N/A (2018). PubMed: 30536257