For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    5ht2a-receptor-antibody-ab216959.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels GPCR Serotonin Receptors
Share by email

Anti-5HT2A Receptor antibody (ab216959)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-5HT2A Receptor antibody (ab216959)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)

Key features and details

  • Rabbit polyclonal to 5HT2A Receptor
  • Suitable for: IHC-P, WB
  • Reacts with: Mouse, Rat
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Primary
Product image
Anti-Choline Acetyltransferase antibody [EPR16590] - BSA and Azide free (ab221793)
Primary
Product image
Anti-Metabotropic Glutamate Receptor 5 antibody [EPR2425Y] (ab76316)

View more associated products

Overview

  • Product name

    Anti-5HT2A Receptor antibody
    See all 5HT2A Receptor primary antibodies
  • Description

    Rabbit polyclonal to 5HT2A Receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human 5HT2A Receptor aa 40-75 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKN


    Database link: P28223
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Rat brain tissues
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • Serotonin Receptors
    • Metabolism
    • Types of disease
    • Obesity

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab216959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe please use a dilution of 1/50 - 1/200.

WB 1/300.

Target

  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Domain

    The PDZ domain-binding motif is involved in the interaction with INADL, CASK, APBA1, DLG1 and DLG4.
  • Cellular localization

    Cell membrane. Localizes to the post-synaptic thickening of axo-dendritic synapses.
  • Target information above from: UniProt accession P28223 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 3356 Human
    • Entrez Gene: 15558 Mouse
    • Entrez Gene: 29595 Rat
    • Omim: 182135 Human
    • SwissProt: P28223 Human
    • SwissProt: P35363 Mouse
    • SwissProt: P14842 Rat
    • Unigene: 654586 Human
    • Unigene: 214351 Mouse
    • Unigene: 10294 Rat
    • Unigene: 146756 Rat
    see all
  • Alternative names

    • 5 HT 2 antibody
    • 5 HT 2A antibody
    • 5 HT2 receptor antibody
    • 5 HT2A antibody
    • 5 hydroxytryptamine receptor 2A antibody
    • 5-HT-2 antibody
    • 5-HT-2A antibody
    • 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody
    • 5-hydroxytryptamine 2A receptor antibody
    • 5-hydroxytryptamine receptor 2A antibody
    • 5HT2A_HUMAN antibody
    • HTR 2 antibody
    • HTR 2A antibody
    • HTR2 antibody
    • HTR2, formerly antibody
    • HTR2A antibody
    • serotonin 5-HT-2 receptor, formerly antibody
    • serotonin 5-HT-2A receptor antibody
    • Serotonin receptor 2A antibody
    see all

Images

  • Western blot - Anti-5HT2A Receptor antibody (ab216959)
    Western blot - Anti-5HT2A Receptor antibody (ab216959)
    Anti-5HT2A Receptor antibody (ab216959) at 1/300 dilution + Mouse cerebellum lysates

    Secondary
    Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)

    Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)

    Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody Goat Anti-Rabbit IgG, Cy3 conjugated, at 1/200 dilution or 40 minutes at 37°C. 

Protocols

  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab216959? Please let us know so that we can cite the reference in this datasheet.

    ab216959 has been referenced in 1 publication.

    • Moghaddam RA  et al. Evaluation of Isolated Vascular Response to 5HT1A, 5HT1B1D & 5HT2A Receptors Agonist & Antagonist in Chronic Endotoxemic Rats. Drug Res (Stuttg) N/A:N/A (2018). PubMed: 30536257

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab216959.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.