Anti-5HT2A Receptor antibody (ab216959)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-5HT2A Receptor antibody
See all 5HT2A Receptor primary antibodies -
Description
Rabbit polyclonal to 5HT2A Receptor -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human 5HT2A Receptor aa 40-75 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKN
Database link: P28223 -
Positive control
- Rat brain tissues
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol
Aqueous buffered solution -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab216959 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. When using a fluorescent probe please use a dilution of 1/50 - 1/200. |
|
| WB | 1/300. |
Target
-
Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Domain
The PDZ domain-binding motif is involved in the interaction with INADL, CASK, APBA1, DLG1 and DLG4. -
Cellular localization
Cell membrane. Localizes to the post-synaptic thickening of axo-dendritic synapses. - Information by UniProt
-
Database links
- Entrez Gene: 3356 Human
- Entrez Gene: 15558 Mouse
- Entrez Gene: 29595 Rat
- Omim: 182135 Human
- SwissProt: P28223 Human
- SwissProt: P35363 Mouse
- SwissProt: P14842 Rat
- Unigene: 654586 Human
see all -
Alternative names
- 5 HT 2 antibody
- 5 HT 2A antibody
- 5 HT2 receptor antibody
see all
Images
-
Western blot - Anti-5HT2A Receptor antibody (ab216959)Anti-5HT2A Receptor antibody (ab216959) at 1/300 dilution + Mouse cerebellum lysates
Secondary
Conjugated secondary antibody at 1/20000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-5HT2A Receptor antibody (ab216959)Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling 5HT2A Receptor with ab216959 at 1/200 dilution, followed by conjugation to the secondary antibody Goat Anti-Rabbit IgG, Cy3 conjugated, at 1/200 dilution or 40 minutes at 37°C.
Protocols
Datasheets and documents
References
This product has been referenced in:
- Moghaddam RA et al. Evaluation of Isolated Vascular Response to 5HT1A, 5HT1B1D & 5HT2A Receptors Agonist & Antagonist in Chronic Endotoxemic Rats. Drug Res (Stuttg) N/A:N/A (2018). Read more (PubMed: 30536257) »
