Overview

  • Product name

    Anti-5HT2C Receptor antibody
    See all 5HT2C Receptor primary antibodies
  • Description

    Rabbit polyclonal to 5HT2C Receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human 5HT2C Receptor aa 400-450. The exact sequence is proprietary. The immunogen spans Gln437.
    Sequence:

    RVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSS V


    Database link: P28335

  • Positive control

    • Human brain cerebellum tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab197776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 52 kDa.
IHC-P Use a concentration of 5 µg/ml.
ICC/IF 1/50 - 1/200.

Target

  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Domain

    The PDZ domain-binding motif is involved in the interaction with MPDZ.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 Hydroxytryptamine 2C receptor antibody
    • 5-HT-1C antibody
    • 5-ht-1c receptor antibody
    • 5-HT-2C antibody
    • 5-HT1C antibody
    • 5-HT2C antibody
    • 5-HTR2C antibody
    • 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled antibody
    • 5-hydroxytryptamine receptor 1C antibody
    • 5-hydroxytryptamine receptor 2C antibody
    • 5HT1C antibody
    • 5HT2C antibody
    • 5HT2C_HUMAN antibody
    • 5HTR2C antibody
    • 5Hydroxytryptamine 2C receptor antibody
    • Htr1c antibody
    • HTR2C antibody
    • serotonin 1c receptor antibody
    • serotonin 2c receptor antibody
    • Serotonin 5-HT-2C receptor antibody
    • Serotonin receptor 2C antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded Human brain cerebellum tissue, labeling 5HT2C Receptor using ab197776 at 5 µg/ml

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up