Overview

  • Product name

    Anti-5HT3B receptor antibody
    See all 5HT3B receptor primary antibodies
  • Description

    Rabbit polyclonal to 5HT3B receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human 5HT3B receptor aa 130-180 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHT V


    Database link: O95264

  • Positive control

    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
  • Tissue specificity

    Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily.
  • Post-translational
    modifications

    N-glycosylation required for membrane localization.
  • Cellular localization

    Cell membrane. Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 HT3 B antibody
    • 5 HT3B antibody
    • 5 HTR3B antibody
    • 5 hydroxytryptamine 3 receptor B subunit antibody
    • 5 hydroxytryptamine receptor 3B antibody
    • 5 hydroxytryptamine serotonin receptor 3B antibody
    • 5-HT3-B antibody
    • 5-HT3B antibody
    • 5-hydroxytryptamine receptor 3B antibody
    • 5HT3B_HUMAN antibody
    • 5HTR3B antibody
    • Htr3b antibody
    • Serotonin gated ion channel subunit antibody
    • Serotonin receptor 3B antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling 5HT3B receptor with ab214211 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up