Anti-68kDa Neurofilament/NF-L antibody [NFL/736] - BSA and Azide free (ab216029)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-68kDa Neurofilament/NF-L antibody [NFL/736] - BSA and Azide free
See all 68kDa Neurofilament/NF-L primary antibodies -
Description
Mouse monoclonal [NFL/736] to 68kDa Neurofilament/NF-L - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Chicken, Cow, Human, Pig -
Immunogen
Recombinant full length protein corresponding to Human 68kDa Neurofilament/NF-L aa 1-543.
Sequence:MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSS LSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDR FASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAA EDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGAD EAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVT KPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRL SFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEE QIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKE ESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
Database link: P07196 -
Positive control
- Rat cerebellum tissue.
-
General notes
Previously labelled as 68kDa Neurofilament.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A/G purified -
Purification notes
ab216029 is purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
NFL/736 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab216029 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. -
Involvement in disease
Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 1F (CMT1F) [MIM:607734]. CMT1F is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. CMT1F is characterized by onset in infancy or childhood (range 1 to 13 years).
Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 2E (CMT2E) [MIM:607684]. CMT2E is an autosomal dominant form of Charcot-Marie-Tooth disease type 2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. -
Sequence similarities
Belongs to the intermediate filament family. -
Domain
The extra mass and high charge density that distinguish the neurofilament proteins from all other intermediate filament proteins are due to the tailpiece extensions. This region may form a charged scaffolding structure suitable for interaction with other neuronal components or ions. -
Post-translational
modificationsO-glycosylated.
Phosphorylated in the Head and Rod regions by the PKC kinase PKN1, leading to inhibit polymerization. - Information by UniProt
-
Database links
- Entrez Gene: 419528 Chicken
- Entrez Gene: 281348 Cow
- Entrez Gene: 4747 Human
- Entrez Gene: 100521224 Pig
- Entrez Gene: 83613 Rat
- Omim: 162280 Human
- SwissProt: P02548 Cow
- SwissProt: P07196 Human
see all -
Alternative names
- 68 kDa neurofilament protein antibody
- 68kDa Neurofilament antibody
- 68kDa neurofilament protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-68kDa Neurofilament/NF-L antibody [NFL/736] - BSA and Azide free (ab216029)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat cerebellum tissue labeling 68kDa Neurofilament/NF-L with ab216029 at 0.5 µg/mL.
Protocols
Datasheets and documents
References
ab216029 has not yet been referenced specifically in any publications.