Overview

  • Product name

    Anti-68kDa Neurofilament/NF-L antibody [NFL/736] - BSA and Azide free
    See all 68kDa Neurofilament/NF-L primary antibodies
  • Description

    Mouse monoclonal [NFL/736] to 68kDa Neurofilament/NF-L - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Chicken, Cow, Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human 68kDa Neurofilament/NF-L aa 1-543.
    Sequence:

    MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSS LSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDR FASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAA EDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGAD EAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVT KPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRL SFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEE QIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKE ESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD


    Database link: P07196

  • Positive control

    • Rat cerebellum tissue.
  • General notes

    Previously labelled as 68kDa Neurofilament. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    ab216029 is purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    NFL/736
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
  • Involvement in disease

    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 1F (CMT1F) [MIM:607734]. CMT1F is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. CMT1F is characterized by onset in infancy or childhood (range 1 to 13 years).
    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 2E (CMT2E) [MIM:607684]. CMT2E is an autosomal dominant form of Charcot-Marie-Tooth disease type 2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Domain

    The extra mass and high charge density that distinguish the neurofilament proteins from all other intermediate filament proteins are due to the tailpiece extensions. This region may form a charged scaffolding structure suitable for interaction with other neuronal components or ions.
  • Post-translational
    modifications

    O-glycosylated.
    Phosphorylated in the Head and Rod regions by the PKC kinase PKN1, leading to inhibit polymerization.
  • Information by UniProt
  • Database links

  • Alternative names

    • 68 kDa neurofilament protein antibody
    • 68kDa Neurofilament antibody
    • 68kDa neurofilament protein antibody
    • CMT1F antibody
    • CMT2E antibody
    • FLJ53642 antibody
    • Light molecular weight neurofilament protein antibody
    • NEFL antibody
    • Neurofilament light antibody
    • Neurofilament light polypeptide 68kDa antibody
    • Neurofilament light polypeptide antibody
    • Neurofilament protein, light chain antibody
    • Neurofilament subunit NF L antibody
    • Neurofilament triplet L protein antibody
    • NF-L antibody
    • NF68 antibody
    • NFL antibody
    • NFL_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat cerebellum tissue labeling 68kDa Neurofilament/NF-L with ab216029 at 0.5 µg/mL.

References

ab216029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up