Overview

  • Product name
  • Description
    Rabbit polyclonal to A3H
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human A3H aa 129-178 (C terminal).
    Sequence:

    SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE


    Database link: Q6NTF7

  • Positive control
    • Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab135335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Relevance
    ARP10 belongs to the cytidine and deoxycytidylate deaminase family. It is a poorly expressed deaminase that is ineffective at inhibiting retroviral replication. ARP10 has DNA deaminase (cytidine deaminase) activity but is not able to mediate G-to-A hypermutation in newly synthesized retroviral DNA. It is present at low level in 293T cells. It is considered an unstable protein, suggesting that it may be degraded by the proteasome (at protein level). Weakly expressed in testis, ovary, fetal liver and skin. There are two named isoforms. ARP10 from old world monkeys has retained its antiviral activity, while it is lost in other primates. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.
  • Cellular localization
    Nucleus. Cytoplasm. Note: Mostly nuclear.
  • Database links
  • Alternative names
    • A3H antibody
    • APOBEC related protein 10 antibody
    • APOBEC3H antibody
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3H antibody
    • ARP 10 antibody
    • ARP10 antibody
    • DNA dC->dU-editing enzyme APOBEC-3H antibody
    see all

Images

  • Anti-A3H antibody (ab135335) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size: 24 kDa

References

ab135335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up