Anti-Argininosuccinate Lyase antibody (ab97370)
Key features and details
- Rabbit polyclonal to Argininosuccinate Lyase
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-Argininosuccinate Lyase antibody
See all Argininosuccinate Lyase primary antibodies -
Description
Rabbit polyclonal to Argininosuccinate Lyase -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human Argininosuccinate Lyase aa 13-231.
Sequence:FVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQ ILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRS RNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQ RAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVD RELLRAELNFGAITLNSMDAPEATLGPCWGCSCGSDPGVGRAGLGGRPVA LLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYF AQRPGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAP EERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQV LPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRE TGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTK
Database link: P04424 -
Positive control
- WB: HepG2. HEK-293T, HeLa, A431 whole cell lysate. Neuro2a, GL261, C8D30, NIH/3T3, BCL-1, Raw 264.7, C2C12 whole cell lysate. ICC/IF: HeLa cells IHC-P: U-87 MG xenograft, C2C12 xenograft tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.025% Proclin 300
Constituents: 79% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab97370 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/3000. Predicted molecular weight: 52 kDa.
|
ICC/IF |
1/100 - 1/200.
|
|
IHC-P |
1/100 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 52 kDa. |
ICC/IF
1/100 - 1/200. |
IHC-P
1/100 - 1/1000. |
Target
-
Pathway
Amino-acid biosynthesis; L-arginine biosynthesis; L-arginine from L-ornithine and carbamoyl phosphate: step 3/3.
Nitrogen metabolism; urea cycle; L-arginine and fumarate from (N(omega)-L-arginino)succinate: step 1/1. -
Involvement in disease
Defects in ASL are the cause of arginosuccinicaciduria (ARGINSA) [MIM:207900]. Arginosuccinicaciduria is an autosomal recessive disorder of the urea cycle. The disease is characterized by mental and physical retardation, liver enlargement, skin lesions, dry and brittle hair showing trichorrhexis nodosa microscopically and fluorescing red, convulsions, and episodic unconsciousness. -
Sequence similarities
Belongs to the lyase 1 family. Argininosuccinate lyase subfamily. -
Post-translational
modificationsAcetylation modifies enzyme activity in response to alterations of extracellular nutrient availability. Acetylation increased with trichostin A (TSA) or with nicotinamide (NAM). Glucose increases acetylation by about a factor of 3 with decreasing enzyme activity. Acetylation on Lys-288 is decreased on the addition of extra amino acids resulting in activation of enzyme activity. - Information by UniProt
-
Database links
- Entrez Gene: 435 Human
- Entrez Gene: 109900 Mouse
- Entrez Gene: 59085 Rat
- Omim: 608310 Human
- SwissProt: P04424 Human
- SwissProt: Q91YI0 Mouse
- SwissProt: P20673 Rat
- Unigene: 632015 Human
see all -
Alternative names
- Argininosuccinase antibody
- Argininosuccinate lyase antibody
- Arginosuccinase antibody
see all
Images
-
Paraffin embedded C2C12 xenograft tissue stained for ASL using ab97370 at 1/500 dilution in immunohistochemical analysis.
-
HeLa cells stained for ASL (green) using ab97370 at 1/500 dilution in ICC/IF.
-
All lanes : Anti-Argininosuccinate Lyase antibody (ab97370) at 1/1000 dilution
Lane 1 : Neuro2a whole cell lysate
Lane 2 : GL261 whole cell lysate
Lane 3 : C8D30 whole cell lysate
Lane 4 : NIH/3T3 whole cell lysate
Lane 5 : BCL-1 whole cell lysate
Lane 6 : Raw 264.7 whole cell lysate
Lane 7 : C2C12 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 52 kDa10% SDS-PAGE.
-
Paraffin embedded U-87 MG xenograft tissue stained for ASL using ab97370 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-Argininosuccinate Lyase antibody (ab97370) at 1/1000 dilution
Lane 1 : HEK-293T whole cell lysate
Lane 2 : A431 whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 52 kDa10% SDS-PAGE.
-
ab97370, at a 1/200 dilution, staining Argininosuccinate Lyase in paraformaldehyde-fixed HeLa cells by Immunofluorescence analysis. Right image is merged with a DNA probe.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (7)
ab97370 has been referenced in 7 publications.
- Zhang W et al. The related mechanism of complete Freund's adjuvant-induced chronic inflammation pain based on metabolomics analysis. Biomed Chromatogr 35:e5020 (2021). PubMed: 33159321
- Lerner S et al. ASL expression in ALDH1A1+ neurons in the substantia nigra metabolically contributes to neurodegenerative phenotype. Hum Genet 140:1471-1485 (2021). PubMed: 34417872
- Drokhlyansky E et al. The Human and Mouse Enteric Nervous System at Single-Cell Resolution. Cell 182:1606-1622.e23 (2020). PubMed: 32888429
- Lerner S et al. ASL Metabolically Regulates Tyrosine Hydroxylase in the Nucleus Locus Coeruleus. Cell Rep 29:2144-2153.e7 (2019). PubMed: 31747589
- Lee JS et al. Urea Cycle Dysregulation Generates Clinically Relevant Genomic and Biochemical Signatures. Cell 174:1559-1570.e22 (2018). PubMed: 30100185
- Baruteau J et al. Argininosuccinic aciduria fosters neuronal nitrosative stress reversed by Asl gene transfer. Nat Commun 9:3505 (2018). PubMed: 30158522
- Marini JC et al. The intestinal-renal axis for arginine synthesis is present and functional in the neonatal pig. Am J Physiol Endocrinol Metab 313:E233-E242 (2017). PubMed: 28611027