Overview

  • Product name
    Anti-C5 / C5a antibody (FITC)
    See all C5 / C5a primary antibodies
  • Description
    Rabbit polyclonal to C5 / C5a (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Pig
  • Immunogen

    Recombinant full length protein corresponding to Pig C5/ C5a aa 1-74.
    Sequence:

    MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKA FKDCCYIANQVRAEQSHKNIQLGR


    Database link: P01032

Properties

Applications

Our Abpromise guarantee covers the use of ab193131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.
    Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C5a also stimulates the locomotion of polymorphonuclear leukocytes (chemokinesis) and direct their migration toward sites of inflammation (chemotaxis).
  • Involvement in disease
    Complement component 5 deficiency
    An association study of C5 haplotypes and genotypes in individuals with chronic hepatitis C virus infection shows that individuals homozygous for the C5_1 haplotype have a significantly higher stage of liver fibrosis than individuals carrying at least 1 other allele (PubMed:15995705).
  • Sequence similarities
    Contains 1 anaphylatoxin-like domain.
    Contains 1 NTR domain.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Anaphylatoxin C5a analog antibody
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4 antibody
    • C5 antibody
    • C5a antibody
    • CO5_HUMAN antibody
    • Complement C5 alpha'' chain antibody
    • Complement C5 antibody
    • Complement component C5 antibody
    • CPAMD4 antibody
    see all

References

ab193131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up