Overview

  • Product name
    Anti-CD300LG antibody
  • Description
    Rabbit polyclonal to CD300LG
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CD300LG aa 41-90 (internal sequence). The exact sequence is proprietary.
    Sequence:

    EELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSL


    Database link: Q6UXG3

  • Positive control
    • WB: L929 cell extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab190752 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific peptide.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 36 kDa.
ELISA 1/10000.

Target

  • Function
    Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle and placenta.
  • Sequence similarities
    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain
    Ig-like V-type domain mediates binding to lymphocyte.
  • Post-translational
    modifications
    O-glycosylated with sialylated oligosaccharides.
  • Cellular localization
    Apical cell membrane. Basolateral cell membrane. Endosome > multivesicular body membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD300 antigen-like family member G antibody
    • CD300 molecule like family member g antibody
    • CD300g antibody
    • Cd300lg antibody
    • CLM-9 antibody
    • CLM9 antibody
    • CLM9_HUMAN antibody
    • CMRF35-like molecule 9 antibody
    • Nepmucin antibody
    • TREM-4 antibody
    • TREM4 antibody
    • Triggering receptor expressed on myeloid cells 4 antibody
    see all

Images

  • Anti-CD300LG antibody (ab190752) at 1/500 dilution + L929 cell extract at 30 µg

    Predicted band size: 36 kDa

References

ab190752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up