
  • Product name
    Anti-Connexin 59/GJA10 antibody
  • Description
    Rabbit polyclonal to Connexin 59/GJA10
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    A synthetic peptide corresponding to a region within amino acids 396 - 445 (DGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK G) of Human Connexin 59/GJA10 (NP_110399)

  • Positive control
    • Fetal brain lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab86414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity
    Highly abundant in skeletal muscle. Also detected in testis.
  • Sequence similarities
    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links
  • Alternative names
    • Connexin 58 antibody
    • Connexin 59 antibody
    • Connexin-58 antibody
    • Connexin-59 antibody
    • Cx58 antibody
    • Cx59 antibody
    • CXA9_HUMAN antibody
    • Gap junction alpha 10 protein antibody
    • Gap junction alpha 9 protein antibody
    • Gap junction alpha-10 protein antibody
    • Gap junction alpha-9 protein antibody
    • GJA9 antibody
    • MGC50985 antibody
    see all


  • Anti-Connexin 59/GJA10 antibody (ab86414) at 1 µg/ml + Human fetal brain lysate at 10 µg

    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 59 kDa

    Gel concentration 12%


ab86414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86414.
Please use the links above to contact us or submit feedback about this product.


Sign up