Overview

  • Product name

  • Description

    Rabbit polyclonal to ETHE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human ETHE1 aa 163-248.
    Sequence:

    RTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLN PRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCG


    Database link: O95571

  • Positive control

    • IHC-P: Human colon tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab251791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probably plays an important role in metabolic homeostasis in mitochondria. May function as a nuclear-cytoplasmic shuttling protein that binds transcription factor RELA/NFKB3 in the nucleus and exports it to the cytoplasm. Suppresses p53-induced apoptosis by preventing nuclear localization of RELA.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in ETHE1 are a cause of ethylmalonic encephalopathy (EE) [MIM:602473]. EE is an autosomal recessive disorder characterized by neurodevelopmental delay and regression, recurrent petechiae, acrocyanosis, diarrhea, leading to death in the first decade of life. It is also associated with persistent lactic acidemia and ethylmalonic and methylsuccinic aciduria.
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
  • Cellular localization

    Cytoplasm. Nucleus. Mitochondrion matrix. According to PubMed:12398897, it is cytoplasmic and nuclear. According to PubMed:14732903, it is found in the mitochondrial matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ethe1 antibody
    • ETHE1 protein, mitochondrial precursor antibody
    • ETHE1_HUMAN antibody
    • ethylmalonic encephalopathy 1 antibody
    • Ethylmalonic encephalopathy protein 1 antibody
    • hepatoma subtracted clone one antibody
    • Hepatoma subtracted clone one protein antibody
    • HSCO antibody
    • mitochondrial antibody
    • Protein ETHE1 antibody
    • Protein ETHE1 mitochondrial antibody
    • YF13H12 antibody
    see all

Images

  • All lanes : Anti-ETHE1 antibody (ab251791) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II whole cell lysate

    Predicted band size: 28 kDa

  • All lanes : Anti-ETHE1 antibody (ab251791) at 0.4 µg/ml

    Lane 1 : RT-4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : Human U-251-MG sp whole cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 28 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ETHE1 (green) using ab251791 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human colon tissue stained for ETHE1 using ab251791 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for ETHE1 using ab251791 at 1/1000 dilution in immunohistochemical analysis.

References

ab251791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab251791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up