Anti-GFPT1 antibody (ab176775)
Key features and details
- Rabbit polyclonal to GFPT1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GFPT1 antibody
See all GFPT1 primary antibodies -
Description
Rabbit polyclonal to GFPT1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human GFPT1 aa 525-681 (C terminal). (BC045641).
Sequence:DEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGE LKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKED TETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNL AKSVTVE
Database link: Q06210-2 -
Positive control
- WB: HeLa and Human kidney lysates. IHC-P: Human fetal testis tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200ul Sterile Distilled Water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176775 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/1000. Predicted molecular weight: 77 kDa.
|
|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
WB
1/200 - 1/1000. Predicted molecular weight: 77 kDa. |
IHC-P
1/100 - 1/500. |
Target
-
Function
Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. -
Tissue specificity
Isoform 1 is predominantly expressed in skeletal muscle. Not expressed in brain. Seems to be selectively expressed in striated muscle. -
Pathway
Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; alpha-D-glucosamine 6-phosphate from D-fructose 6-phosphate: step 1/1. -
Involvement in disease
Defects in GFPT1 are the cause of limb-girdle myasthenia with tubular aggregates (LGMTA) [MIM:610542]. A congenital myasthenic syndrome characterized by onset of proximal muscle weakness in the first decade. Individuals with this condition have a recognizable pattern of weakness of shoulder and pelvic girdle muscles, and sparing of ocular or facial muscles. EMG classically shows a decremental response to repeated nerve stimulation, a sign of neuromuscular junction dysfunction. Affected individuals show a favorable response to acetylcholinesterase (AChE) inhibitors. -
Sequence similarities
Contains 1 glutamine amidotransferase type-2 domain.
Contains 2 SIS domains. - Information by UniProt
-
Database links
- Entrez Gene: 2673 Human
- Entrez Gene: 14583 Mouse
- Entrez Gene: 297417 Rat
- Omim: 138292 Human
- SwissProt: Q06210 Human
- SwissProt: P47856 Mouse
- SwissProt: P82808 Rat
- Unigene: 580300 Human
-
Alternative names
- CMS12 antibody
- CMSTA1 antibody
- D-fructose-6-phosphate amidotransferase 1 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab176775 has been referenced in 4 publications.
- Zhao Y et al. Human metapneumovirus infection of airway epithelial cells is associated with changes in core metabolic pathways. Virology 531:183-191 (2019). PubMed: 30927711
- Li L et al. High expression of GFAT1 predicts unfavorable prognosis in patients with hepatocellular carcinoma. Oncotarget 8:19205-19217 (2017). IHC ; Human . PubMed: 28186970
- Yang C et al. High expression of GFAT1 predicts poor prognosis in patients with pancreatic cancer. Sci Rep 6:39044 (2016). PubMed: 27996048
- Duan F et al. Loss of GFAT1 promotes epithelial-to-mesenchymal transition and predicts unfavorable prognosis in gastric cancer. Oncotarget 7:38427-39 (2016). PubMed: 27509259