Anti-GGT1/GGT antibody [1F9] (ab55138)
Key features and details
- Mouse monoclonal [1F9] to GGT1/GGT
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-GGT1/GGT antibody [1F9]
See all GGT1/GGT primary antibodies -
Description
Mouse monoclonal [1F9] to GGT1/GGT -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human GGT1/GGT aa 381-470.
Sequence:TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSIT NEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Database link: P19440 -
General notes
This product was changed from ascites to tissue culture supernatant on 20th Jan 2020. Lot numbers higher than GR3280625 are from tissue culture supernatant. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
1F9 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab55138 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use at an assay dependent concentration. Predicted molecular weight: 61 kDa.
|
IHC-P | (7) |
Use at an assay dependent concentration.
|
ICC/IF | (2) |
Use at an assay dependent concentration.
|
Flow Cyt |
Use at an assay dependent concentration.
ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 61 kDa. |
IHC-P
Use at an assay dependent concentration. |
ICC/IF
Use at an assay dependent concentration. |
Flow Cyt
Use at an assay dependent concentration. ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracelular GSH level. It is part of the cell antioxidant defense mechanism. Catalyzes the transfer of the glutamyl moiety of glutathione to amino acids and dipeptide acceptors. Alternatively, glutathione can be hydrolyzed to give Cys-Gly and gamma glutamate. Isoform 3 seems to be inactive. -
Tissue specificity
Detected in fetal and adult kidney and liver, adult pancreas, stomach, intestine, placenta and lung. Isoform 3 is lung-specific. There are several other tissue-specific forms that arise from alternative promoter usage but that produce the same protein. -
Pathway
Sulfur metabolism; glutathione metabolism. -
Involvement in disease
Defects in GGT1 are a cause of glutathionuria (GLUTH) [MIM:231950]; also known as gamma-glutamyltranspeptidase deficiency. It is an autosomal recessive disease. -
Sequence similarities
Belongs to the gamma-glutamyltransferase family. -
Post-translational
modificationsN-glycosylated on both chains. Contains hexoses, hexosamines and sialic acid residues. Glycosylation profiles tested in kidney and liver tissues reveal the presence of tissue-specific and site-specific glycan composition, despite the overlap in composition among the N-glycans. A total of 36 glycan compositions, with 40 unique structures are observed. Up to 15 different glycans are observed at a single site, with site-specific variation in glycan composition. The difference in glycosylation profiles in the 2 tissues do not affect the enzyme activity. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2678 Human
- Entrez Gene: 14598 Mouse
- Omim: 612346 Human
- SwissProt: P19440 Human
- SwissProt: Q60928 Mouse
- Unigene: 595809 Human
- Unigene: 645535 Human
- Unigene: 4559 Mouse
-
Alternative names
- CD224 antibody
- D22S672 antibody
- D22S732 antibody
see all
Images
-
GGT1/GGT antibody (ab55138) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human testis.
This image was generated using the ascites version of the product.
-
GGT1/GGT antibody (ab55138) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
ICC/IF image of ab55138 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HEK293 cells stained with ab55138 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
Datasheet download
References (11)
ab55138 has been referenced in 11 publications.
- Dayton JR et al. Expression of IL-20 Receptor Subunit β Is Linked to EAE Neuropathology and CNS Neuroinflammation. Front Cell Neurosci 15:683687 (2021). PubMed: 34557075
- Mendiola AS et al. Transcriptional profiling and therapeutic targeting of oxidative stress in neuroinflammation. Nat Immunol 21:513-524 (2020). PubMed: 32284594
- Pan C et al. Pretreatment with human urine-derived stem cells protects neurological function in rats following cardiopulmonary resuscitation after cardiac arrest. Exp Ther Med 20:112 (2020). PubMed: 32989390
- Tysoe OC et al. Isolation and propagation of primary human cholangiocyte organoids for the generation of bioengineered biliary tissue. Nat Protoc 14:1884-1925 (2019). PubMed: 31110298
- Dayton JR et al. Straightforward method for singularized and region-specific CNS microvessels isolation. J Neurosci Methods 318:17-33 (2019). PubMed: 30797797