Overview

  • Product name

  • Description

    Rabbit polyclonal to GRF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GRF2 aa 91-227.
    Sequence:

    SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQ NDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKG VIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK


    Database link: Q13905

  • Positive control

    • IHC-P: Human skeletal muscle tissue. WB: GRF2 overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab251683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 121 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Guanine nucleotide-releasing protein that binds to SH3 domain of CRK and GRB2/ASH. Transduces signals from CRK to activate RAS.
  • Tissue specificity

    Ubiquitously expressed in adult and fetus. Expression is high in adult skeletal muscle and placenta and in fetal brain and heart. Low levels of expression in adult and fetal liver.
  • Sequence similarities

    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-GEF domain.
  • Information by UniProt
  • Database links

  • Form

    It localizes to cytoplasm and endosomes.
  • Alternative names

    • C3G antibody
    • C3G protein antibody
    • CRK SH3 binding GNRP antibody
    • CRK SH3-binding GNRP antibody
    • DKFZp781P1719 antibody
    • GRF 2 antibody
    • GRF2 antibody
    • Guanine nucleotide releasing factor 2 (specific for crk proto oncogene) antibody
    • Guanine nucleotide releasing factor 2 antibody
    • Guanine nucleotide-releasing factor 2 antibody
    • OTTHUMP00000064558 antibody
    • Protein C3G antibody
    • Rap guanine nucleotide exchange factor (GEF) 1 antibody
    • Rap guanine nucleotide exchange factor 1 antibody
    • RAPGEF 1 antibody
    • RAPGEF1 antibody
    • RPGF1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for GRF2 using ab251683 at 1/50 dilution in immunohistochemical analysis.
  • All lanes : Anti-GRF2 antibody (ab251683) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : GRF2 overexpression HEK-293T cell lysate

    Predicted band size: 121 kDa

References

ab251683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab251683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up