Anti-GRO gamma antibody (ab10064)
- Datasheet
- References (2)
- Protocols
Overview
-
Product name
Anti-GRO gamma antibody
See all GRO gamma primary antibodies -
Description
Rabbit polyclonal to GRO gamma -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Pig -
Immunogen
Synthetic peptide corresponding to Human GRO gamma aa 58-107 conjugated to keyhole limpet haemocyanin.
Sequence:QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
-
Positive control
- HeLa whole cell lysate.
-
General notes
CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading...
-
Purity
Protein A purified -
Primary antibody notes
CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab10064 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000. Detects a band of approximately 11 kDa (predicted molecular weight: 12.7 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. | |
IHC-P | Use at an assay dependent concentration. |
Target
-
Function
Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsN-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 2921 Human
- Omim: 139111 Human
- SwissProt: P19876 Human
- Unigene: 89690 Human
-
Alternative names
- C-X-C motif chemokine 3 antibody
- C-X-C motif chemokine ligand 3 antibody
- Chemokine (C X C motif) ligand 3 antibody
see all
Images
Datasheets and documents
References
This product has been referenced in:
- Han KQ et al. Chemokine CXCL1 may serve as a potential molecular target for hepatocellular carcinoma. Cancer Med 5:2861-2871 (2016). Read more (PubMed: 27682863) »
- Han KQ et al. Inflammatory microenvironment and expression of chemokines in hepatocellular carcinoma. World J Gastroenterol 21:4864-74 (2015). IHC-P ; Mouse . Read more (PubMed: 25944999) »