For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    gro-gamma-antibody-ab10064.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Alpha Chemokines (CXC)
Share by email

Anti-GRO gamma antibody (ab10064)

  • Datasheet
Reviews (1)Q&A (1)References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-GRO gamma antibody (ab10064)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References (2)
  • Protocols

Overview

  • Product name

    Anti-GRO gamma antibody
    See all GRO gamma primary antibodies
  • Description

    Rabbit polyclonal to GRO gamma
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide corresponding to Human GRO gamma aa 58-107 conjugated to keyhole limpet haemocyanin.
    Sequence:

    QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa whole cell lysate.
  • General notes


    CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Primary antibody notes

    CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Innate Immunity
    • Chemokines
    • Alpha Chemokines (CXC)

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab10064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 11 kDa (predicted molecular weight: 12.7 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P19876 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2921 Human
    • Omim: 139111 Human
    • SwissProt: P19876 Human
    • Unigene: 89690 Human
    • Alternative names

      • C-X-C motif chemokine 3 antibody
      • C-X-C motif chemokine ligand 3 antibody
      • Chemokine (C X C motif) ligand 3 antibody
      • Chemokine (CXC motif) ligand 3 antibody
      • Cinc 2 antibody
      • CINC 2b antibody
      • Cinc2 antibody
      • CINC2b antibody
      • CXCL 3 antibody
      • Cxcl3 antibody
      • CXCL3_HUMAN antibody
      • Cytokine induced neutrophil chemoattractant 2 antibody
      • Dcip1 antibody
      • Dendritic cell inflammatory protein 1 antibody
      • Gm1960 antibody
      • GRO protein gamma antibody
      • GRO-gamma antibody
      • GRO-gamma(1-73) antibody
      • GRO-gamma(5-73) antibody
      • GRO3 antibody
      • GRO3 oncogene antibody
      • GROG antibody
      • Growth regulated protein gamma antibody
      • Growth-regulated protein gamma antibody
      • Macrophage inflammatory protein 2 beta precursor antibody
      • Macrophage inflammatory protein 2-beta antibody
      • Melanoma growth stimulatory activity gamma antibody
      • Member 3 antibody
      • MGSA gamma antibody
      • MIP 2b antibody
      • MIP2-beta antibody
      • MIP2B antibody
      • SCYB3 antibody
      • Small inducible cytokine subfamily B antibody
      see all

    Images

    • Western blot - Anti-GRO gamma antibody (ab10064)
      Western blot - Anti-GRO gamma antibody (ab10064)
      ab10064 at 1/1000 dilution staining approximately 11kDa band of human CXCL3 in HeLa whole cell lysate by Western blot (ECL). ab10064 at 1/1000 dilution staining approximately 11kDa band of human CXCL3 in HeLa whole cell lysate by Western blot (ECL).

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Datasheets and documents

    • Datasheet
  • References

    This product has been referenced in:

    • Han KQ  et al. Chemokine CXCL1 may serve as a potential molecular target for hepatocellular carcinoma. Cancer Med 5:2861-2871 (2016). Read more (PubMed: 27682863) »
    • Han KQ  et al. Inflammatory microenvironment and expression of chemokines in hepatocellular carcinoma. World J Gastroenterol 21:4864-74 (2015). IHC-P ; Mouse . Read more (PubMed: 25944999) »
    See all 2 Publications for this product

    Publishing research using ab10064? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-GRO gamma antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Human Tissue sections (Human Tissue sections (Intervertebral Discs))
    Specification
    Human Tissue sections (Intervertebral Discs)
    Fixative
    Paraformaldehyde
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Tris Buffer pH:9,5 for 2x5’ in MW 40% power
    Permeabilization
    No
    Blocking step
    Serum as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 1% · Temperature: 22°C
    Read More

    Abcam user community

    Verified customer

    Submitted Apr 11 2012

    Question

    Phone call enquiring after testing discounts for ab86436, ab9841 and ab10064.

    Read More

    Abcam community

    Verified customer

    Asked on Feb 03 2012

    Answer

    Thank you for contacting us today.

    I am very pleased to hear you would like to test ab86436, ab9841and ab10064with IHC ofparaffin embedded human tissue sections. The codes below will each give you 1 freeprimary antibodybefore the expiration date. To redeem this offer, please submit an Abreview forIHC-P and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site:

    https://www.abcam.com/Abreviews


    ab86436
    DISCOUNT CODE: xxxxx

    Expiration date: 2012-06-04


    ab9841
    DISCOUNT CODE: xxxxx

    Expiration date: 2012-06-04

    ab10064

    DISCOUNT CODE: xxxxxx

    Expiration date: 2012-06-04

    As discussed over the phone, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests whatever they may be. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways:

    1) Call to place your order and mention the code to our customer service department;
    2) Include the code in your fax order;
    3) Place your order on the web and enter the promotional code.

    Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

    The terms and conditions applicable to this offer can be found here:

    https://www.abcam.com/collaborationdiscount

    Read More

    Abcam Scientific Support

    Answered on Feb 03 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.