Anti-HCN1 antibody [N70/28] - C-terminal (HRP) (ab183409)

Overview

  • Product name
    Anti-HCN1 antibody [N70/28] - C-terminal (HRP)
    See all HCN1 primary antibodies
  • Description
    Mouse monoclonal [N70/28] to HCN1 - C-terminal (HRP)
  • Host species
    Mouse
  • Conjugation
    HRP
  • Specificity
    No cross-reactivity against HCN2.
  • Tested applications
    Suitable for: WB, ICC/IF, IHC-P, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant fragment corresponding to Rat HCN1 aa 778-910 (C terminal). NCBI Accession No. NP_445827.1
    Sequence:

    TPGSSTPKNEVHKSTQALHNTHLTREVRPLSASQPSLPHEVSTMISRPHP TVGESLASIPQPVATVHSTGLQAGSRSTVPQRVTLFRQMSSGAIPPNRGV PPAPPPPAAVQRESPSVLNKDPDAEKPRFASNL


    Database link: Q9JKB0

  • Positive control
    • Rat brain and brain membrane lysates. Mouse cerebellum mouse brain tissue sections.
  • General notes

    The clone number has been updated from S70-28 to N70/28, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab183409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 102 kDa.

1 μg/mL of ab183409 was sufficient for detection of rat HCN1 in 10 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

ICC/IF Use a concentration of 1 - 10 µg/ml.
IHC-P Use a concentration of 0.1 - 1 µg/ml.
IHC-Fr Use a concentration of 0.1 - 1 µg/ml.

Target

  • Function
    Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Activated by cAMP, and at 10-100 times higher concentrations, also by cGMP. May mediate responses to sour stimuli.
  • Tissue specificity
    Detected in brain, in particular in amygdala and hippocampus, while expression in caudate nucleus, corpus callosum, substantia nigra, subthalamic nucleus and thalamus is very low or not detectable. Detected at very low levels in muscle and pancreas.
  • Sequence similarities
    Belongs to the potassium channel HCN family.
    Contains 1 cyclic nucleotide-binding domain.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • BCNG-1 antibody
    • BCNG1 antibody
    • Brain cyclic nucleotide gated channel 1 antibody
    • Brain cyclic nucleotide-gated channel 1 antibody
    • HAC 2 antibody
    • HAC2 antibody
    • HCN1 antibody
    • HCN1_HUMAN antibody
    • Hyperpolarization activated cyclic nucleotide gated potassium channel 1 antibody
    • Potassium channel, voltage-gated, brain, 1 antibody
    • Potassium/sodium hyperpolarization activated cyclic nucleotide gated channel 1 antibody
    • Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 antibody
    see all

References

ab183409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up