Overview

  • Product name
  • Description
    Rabbit polyclonal to Hsp70
  • Host species
    Rabbit
  • Specificity
    Detects a 70kDa protein corresponding to the molecular mass of inducible hsp70. May cross-react with Hsc70 at lower dilutions.
  • Tested applications
    Suitable for: IHC-Fr, ICC/IF, WB, IP, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Macaque monkey, African green monkey, Chinese hamster, Orangutan, Bos mutus grunniens, Saguinus oedipus
  • Immunogen

    Full length protein corresponding to Human Hsp70 aa 1-641.
    Sequence:

    MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL IGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDK PKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYF NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHK KDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLS LGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT KDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANK ITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD


    Database link: P08107

  • Positive control
    • WB: HeLa, A431, A549, HCT116, HEK-293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G and rat brain tumour lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab79852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
ICC/IF 1/100.
WB 1/10000. Detects a band of approximately 70 kDa.
IP 1/100.
IHC-P 1/100.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific.
  • Cellular localization
    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Database links
  • Alternative names
    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1A antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Images

  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Cell lysates prepared from mouse Pam212 cells
    Lane 2 : Molecular weight marker
  • Immunohistochemistry of human colon carcinoma staining Hsp70 using ab79852 at 1:50000. A Biotin conjugated Goat Anti-Rabbit antibody at 1:2000 was used as a secondary antibody and Methyl Green at 200uL was used to counter stain.

  • Immunocytochemistry/Immunofluorescence analysis of heat shocked HeLa cells staining Hsp70 using ab79852 at a 1:100 dilution. The secondary antibody was a FITC conjugated Goat Anti-Rabbit (green) at a 1:200 dilution. Counterstain: DAPI (blue) nuclear stain at 1:40000. A) DAPI (blue) nuclear stain. (B) Anti-Hsp70 Antibody. (C) Composite.

  • ab79852 staining Hsp70 in mouse backskin tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).

  • All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution

    Lane 1 : Molecular weight marker
    Lane 2 : Cell lysates prepared from human A431 cells
    Lane 3 : Cell lysates prepared from human A549 cells
    Lane 4 : Cell lysates prepared from human HCT116 cells
    Lane 5 : Cell lysates prepared from Hela cells
    Lane 6 : Cell lysates prepared from HEK293 cells
    Lane 7 : Cell lysates prepared from HepG2 cells
    Lane 8 : Cell lysates prepared from HL-60 cells
    Lane 9 : Cell lysates prepared from HUVEC cells
    Lane 10 : Cell lysates prepared from Jurkat cells
    Lane 11 : Cell lysates prepared from MCF7 cells
    Lane 12 : Cell lysates prepared from PC3 cells
    Lane 13 : Cell lysates prepared from T98G cells
    Lane 14 : Tissue lysates prepared from Rat brain

References

This product has been referenced in:
  • Dunne M  et al. Hyperthermia-mediated drug delivery induces biological effects at the tumor and molecular levels that improve cisplatin efficacy in triple negative breast cancer. J Control Release 282:35-45 (2018). Read more (PubMed: 29673642) »
  • Hou HW  et al. Triptolide exerts protective effects against fibrosis following ileocolonic anastomosis by mechanisms involving the miR-16-1/HSP70 pathway in IL-10-deficient mice. Int J Mol Med 40:337-346 (2017). WB ; Mouse . Read more (PubMed: 28627592) »
See all 11 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
gelatin in KPBS as blocking agent for 15 minute(s) · Concentration: 1% · Temperature: 21°C
Sample
Mouse Cell (Quadriceps Tissue)
Specification
Quadriceps Tissue
Permeabilization
No
Fixative
none

Abcam user community

Verified customer

Submitted Jan 07 2015

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
BSA as blocking agent for 20 minute(s) · Concentration: 5% · Temperature: RT°C
Sample
Human Cell (HUVEC)
Specification
HUVEC
Permeabilization
Yes - 0.1% v/v Triton X-100 pH 7.4 for 5 min at RT
Fixative
Paraformaldehyde

Dr. Dimitra Kalamida

Verified customer

Submitted Nov 21 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up