Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-12RB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human IL-12RB2 aa 326-375 (internal sequence). The exact sequence is proprietary. Isoform 2.
    Sequence:

    DVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQ


    Database link: Q99665-2

  • Positive control

    • Human 721_B cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 75 kDa.

Target

  • Function

    Receptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing IFN-gamma production.
  • Tissue specificity

    Isoform 2 is expressed at similar levels in both naive and activated T-cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
  • Developmental stage

    Maximum levels in Th1 cells between day 3 and day 8 of activation.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    On IL12 binding, phosphorylated on C-terminal tyrosine residues by JAK2. Phosphorylation on Tyr-800 is required for STAT4 binding and activation, and for SOCS3 binding.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • I12R2_HUMAN antibody
    • IL-12 receptor subunit beta-2 antibody
    • IL-12R subunit beta-2 antibody
    • IL-12R-beta-2 antibody
    • IL-12RB2 antibody
    • IL12 receptor beta 2 antibody
    • IL12R beta2 antibody
    • IL12RB2 antibody
    • Interleukin 12 receptor beta 2 antibody
    • Interleukin 12 receptor beta 2 chain antibody
    • Interleukin-12 receptor subunit beta-2 antibody
    • RP11 102M16.1 antibody
    see all

Images

  • Anti-IL-12RB2 antibody (ab182093) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 75 kDa

References

ab182093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Tissue lysate - whole (spleen and aorta)
Gel Running Conditions
Non-reduced Non-Denaturing (Native) (gel 10%)
Loading amount
30 µg
Specification
spleen and aorta
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 16°C

Abcam user community

Verified customer

Submitted Feb 09 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up