Anti-IL-7 antibody (ab175380)
Key features and details
- Rabbit polyclonal to IL-7
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-IL-7 antibody
See all IL-7 primary antibodies -
Description
Rabbit polyclonal to IL-7 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Human IL-7 aa 1-177.
Sequence:MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLD SMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDF DLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKL NDLCFLKRLLQEIKTCWNKILMGTKEH
Database link: P13232 -
Positive control
- HepG2 cell extract.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175380 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
WB | (3) |
1/500 - 1/2000. Predicted molecular weight: 20 kDa.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
WB
1/500 - 1/2000. Predicted molecular weight: 20 kDa. |
Target
-
Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. -
Sequence similarities
Belongs to the IL-7/IL-9 family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3574 Human
- Entrez Gene: 16196 Mouse
- Entrez Gene: 25647 Rat
- Omim: 146660 Human
- SwissProt: P13232 Human
- SwissProt: P10168 Mouse
- SwissProt: P56478 Rat
- Unigene: 591873 Human
see all -
Alternative names
- IL 7 antibody
- IL-7 antibody
- Il7 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175380 has been referenced in 1 publication.
- Muñoz DP et al. Targetable mechanisms driving immunoevasion of persistent senescent cells link chemotherapy-resistant cancer to aging. JCI Insight 5:N/A (2019). PubMed: 31184599