Overview

  • Product name
    Anti-KCNU1 antibody [N2/16] - C-terminal
  • Description
    Mouse monoclonal [N2/16] to KCNU1 - C-terminal
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, IHC-Fr, ICC/IFmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein corresponding to Mouse KCNU1 aa 1052-1121 (C terminal). AAB99742
    Sequence:

    DSSPSIQAQNNSTNATTPLAQGSNFFDSHHADESHDLYPVDDTGERWSQH HHSRVYPLDTLDASDIVQEK


    Database link: O54982

  • Positive control
    • WB: Rat brain membrane lysate.
  • General notes

    The clone number has been updated from S2-16 to N2/16, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab94586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 130 kDa.
IHC-P Use a concentration of 0.1 - 1 µg/ml.

Use at a concentration of 0.1-1.0µg/mL (perox) or 1.0-10µg/mL (IF).

IHC-Fr Use a concentration of 0.1 - 1 µg/ml.

Use at a concentration of 0.1-1.0µg/mL (perox) or 1.0-10µg/mL (IF).

ICC/IF Use a concentration of 1 - 10 µg/ml.

Use at a concentration of 0.1-1.0µg/mL (perox) or 1.0-10µg/mL (IF).

Target

  • Function
    Testis-specific potassium channel activated by both intracellular pH and membrane voltage that mediates export of K(+). May represent the primary spermatozoan K(+) current. In contrast to KCNMA1/SLO1, it is not activated by Ca(2+) or Mg(2+). Critical for fertility. May play an important role in sperm osmoregulation required for the acquisition of normal morphology and motility when faced with osmotic challenges, such as those experienced after mixing with seminal fluid and entry into the vagina.
  • Tissue specificity
    Testis-specific.
  • Sequence similarities
    Belongs to the potassium channel family. Calcium-activated (TC 1.A.1.3) subfamily. KCa5.1/KCNU1 sub-subfamily.
    Contains 1 RCK N-terminal domain.
  • Domain
    The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.
    The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium.
    The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel.
    The C-terminal cytosolic region confers the pH-dependence.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • subfamily M subunit alpha-3 antibody
    • Calcium activated potassium channel subfamily M subunit alpha 3 antibody
    • Calcium activated potassium channel subunit alpha 3 antibody
    • Calcium-activated potassium channel antibody
    • Calcium-activated potassium channel subunit alpha-3 antibody
    • KCa5 antibody
    • KCa5.1 antibody
    • Kcnma3 antibody
    • KCNMC1 antibody
    • KCNU 1 antibody
    • KCNU1 antibody
    • KCNU1_HUMAN antibody
    • Potassium channel subfamily U member 1 antibody
    • Slo3 antibody
    • Slowpoke homolog 3 antibody
    see all

Images

  • Anti-KCNU1 antibody [N2/16] - C-terminal (ab94586) at 1/1000 dilution + Rat brain membrane lysate at 15 µg

    Secondary
    Sheep Anti-Mouse IgG: HRP

    Predicted band size: 130 kDa



    Block: 1.5% BSA for 30 minutes at RT.

    Primary antibody incubated for 2 hours at RT.

    Secondary antibody incubated for 1 hour at RT.

References

ab94586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up