Overview

  • Product name
  • Description
    Rabbit polyclonal to LPCAT1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to an internal region within amino acids 324-373 (

    RLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFA

    ) of Human LPCAT1 (NP_079106)

  • Positive control
    • Human fetal small intestine lysate IF/ICC: A549 cell line.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab94903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology.
  • Pathway
    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities
    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
    Contains 2 EF-hand domains.
  • Domain
    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine.
    The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1 acylglycerophosphocholine O acyltransferase antibody
    • 1 alkylglycerophosphocholine O acetyltransferase antibody
    • 1-acylglycerophosphocholine O-acyltransferase antibody
    • 1-alkylglycerophosphocholine O-acetyltransferase antibody
    • Acetyl CoA:lyso PAF acetyltransferase antibody
    • Acetyl CoA:lyso platelet activating factor acetyltransferase antibody
    • Acetyl-CoA:lyso-PAF acetyltransferase antibody
    • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase antibody
    • Acyl CoA:lysophosphatidylcholine acyltransferase 1 antibody
    • Acyltransferase like 2 antibody
    • Acyltransferase-like 2 antibody
    • AGPAT10 antibody
    • AGPAT9 antibody
    • AYTL1 antibody
    • AYTL2 antibody
    • FLJ12443 antibody
    • FLJ41609 antibody
    • LPC acyltransferase 1 antibody
    • LPC acyltransferase antibody
    • lpcat antibody
    • LPCAT-1 antibody
    • LPCAT1 antibody
    • Lyso PAF acetyltransferase antibody
    • Lyso-PAF acetyltransferase antibody
    • LysoPAFAT antibody
    • LysoPC acyltransferase 1 antibody
    • Lysophosphatidylcholine acyltransferase 1 antibody
    • PCAT1_HUMAN antibody
    • PFAAP3 antibody
    • Phosphonoformate immuno associated protein 3 antibody
    • Phosphonoformate immuno-associated protein 3 antibody
    see all

Images

  • ICC/IF image of ab94903 stained A549 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab94903, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM

  • Anti-LPCAT1 antibody (ab94903) at 1 µg/ml + Human fetal small intestine lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 59 kDa

References

This product has been referenced in:
  • Wu H  et al. Hypoxia-mediated impaired erythrocyte Lands' Cycle is pathogenic for sickle cell disease. Sci Rep 6:29637 (2016). WB ; Mouse, Human . Read more (PubMed: 27436223) »
  • Gao L  et al. Steroid receptor coactivators 1 and 2 mediate fetal-to-maternal signaling that initiates parturition. J Clin Invest 125:2808-24 (2015). Read more (PubMed: 26098214) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for your reply.

Regarding a positive control, I would like to recommend the following:

ab29277 - Small intestine (Human) Whole Cell Lysate - fetal normal tissue
ab30203 - Kidney (Human) Tissue Lysate - adult normal tissue
ab29816 - Pancreas (Human) Tissue Lysate - adult normal tissue

I hope this information is helpful. Please do not hesitate to contact me if you have any additional questions.

Read More

Question
Answer

I am very pleased to hear you would like to accept our offer and test ab94903 in rat in WB. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for rat in WB and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you very much for your interest in ab94903.

To our knowledge, ab94903 has not been tested in rat in WB. Therefore, I can offer a discount off a future purchase if you buy ab94903 now, test it in rat in WB and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.

If you are interested in this offer, please follow these steps:
1. Reply to this e-mail to let me know that you would like to proceed and test ab94903 in rat in WB. I will then send a discount code. This code must be issued before purchasing ab94903 so please wait for my reply before ordering.
2. Purchase ab94903 either by phone, fax, or online (www.abcam.com).
3. Test it in rat in WB.
4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.
5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab94903 turns out to be unsuitable for rat in WB, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up