Anti-MTMR11 antibody - N-terminal (ab187105)

Overview

  • Product name

    Anti-MTMR11 antibody - N-terminal
  • Description

    Rabbit polyclonal to MTMR11 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human MTMR11 aa 21-70 (N terminal). The exact sequence is proprietary.
    Sequence:

    MGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRKGLEPELSGTL


    Database link: A4FU01-5

  • Positive control

    • 786-0 Whole Cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab187105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.

Target

  • Function

    Probable pseudophosphatase. Contains a Glu residue instead of a conserved Cys residue in the dsPTPase catalytic loop which renders it catalytically inactive as a phosphatase.
  • Tissue specificity

    Expressed in bone marrow, spleen and thymus.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily.
    Contains 1 myotubularin phosphatase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cisplatin resistance-associated protein antibody
    • CRA antibody
    • hCRA antibody
    • Mtmr11 antibody
    • MTMRB_HUMAN antibody
    • Myotubularin-related protein 11 antibody
    see all

Images

  • Anti-MTMR11 antibody - N-terminal (ab187105) at 1 µg/ml + 786-0 Whole Cell lysates at 10 µg

References

ab187105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up