Anti-ODR4/TTG1 antibody (ab121495)
Key features and details
- Rabbit polyclonal to ODR4/TTG1
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ODR4/TTG1 antibody -
Description
Rabbit polyclonal to ODR4/TTG1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human ODR4/TTG1 aa 339-421.
Sequence:FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLE IAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
-
Positive control
- Human pancreas tissue; RT-4 and U-251 MG cell lysates; Human Liver lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121495 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
IHC-P |
1/200 - 1/500.
|
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 51 kDa.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
IHC-P
1/200 - 1/500. |
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 51 kDa. |
Target
-
Function
May play a role in the trafficking of a subset of G-protein coupled receptors. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Belongs to the ODR-4 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 54953 Human
- Entrez Gene: 226499 Mouse
- Omim: 609335 Human
- SwissProt: Q5SWX8 Human
- SwissProt: Q4PJX1 Mouse
- Unigene: 371210 Human
-
Alternative names
- C1orf27 antibody
- Chromosome 1 open reading frame 27 antibody
- hODR-4 antibody
see all
Images
-
All lanes : Anti-ODR4/TTG1 antibody (ab121495) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human Plasma lysate
Lane 4 : Human Liver lysate
Lane 5 : Human Tonsil lysate
Predicted band size: 51 kDaDeveloped using the ECL technique
-
Immunofluorescent staining of Human cell line A-431 shows positivity in plasma membrane. Recommended concentration of ab121495 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
ab121495 staining ODR4/TTG1 in paraffin-embedded Human pancreas tissue by Immunohistochemistry.
-
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab121495 has been referenced in 1 publication.
- Yu X et al. Ginkgo biloba leaf extract prevents diabetic nephropathy through the suppression of tissue transglutaminase. Exp Ther Med 21:333 (2021). PubMed: 33732306