Overview

  • Product name

    Anti-PLAGL1 / ZAC antibody [8D8C5]
    See all PLAGL1 / ZAC primary antibodies
  • Description

    Mouse monoclonal [8D8C5] to PLAGL1 / ZAC
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human PLAGL1/ ZAC aa 118-222. (Expressed in E.coli).
    Sequence:

    GDLTCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYT RKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQ TGDLL


    Database link: Q9UM63

  • Positive control

    • Human PLAGL1 / ZAC recombinant protein; PLAGL1 / ZAC (aa: 118-222)-hIgGFc transfected HEK293 cell lysate; Human ovarian cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab181457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 51 kDa.
IHC-P 1/200 - 1/1000.

Target

  • Function

    Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781P1017 antibody
    • Lost on transformation 1 antibody
    • Lost on Transformation antibody
    • LOT-1 antibody
    • LOT1 antibody
    • MGC126275 antibody
    • MGC126276 antibody
    • PLAG like 1 antibody
    • PLAGL1 antibody
    • PLAL1_HUMAN antibody
    • Pleiomorphic adenoma gene like 1 antibody
    • Pleiomorphic adenoma gene like protein 1 antibody
    • Pleiomorphic adenoma-like protein 1 antibody
    • Tumor supressor ZAC antibody
    • ZAC antibody
    • ZAC tumor supressor antibody
    • ZAC1 antibody
    • Zinc finger protein PLAGL1 antibody
    see all

Images

  • All lanes : Anti-PLAGL1 / ZAC antibody [8D8C5] (ab181457) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : PLAGL1 / ZAC (aa: 118-222)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 51 kDa

  • Anti-PLAGL1 / ZAC antibody [8D8C5] (ab181457) at 1/500 dilution + Human PLAGL1 / ZAC recombinant protein

    Predicted band size: 51 kDa



    Expected MWt is 37.5 kDa.

  • Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling PLAGL1 / ZAC with ab181457 at 1/200 dilution, with DAB staining.

References

ab181457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
ChIP
Sample
Cow Tissue lysate - whole (Day ~105 fetal heart)
Negative control
PCR negative control: non-template control ChIP negative control: protein A/G magnetic beads (Millipore Magna ChIP A/G (#17-10085)
Specification
Day ~105 fetal heart
Detection step
Other
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: 1% Formaldehyde (Sigma F8775)
Positive control
PCR positive control: genomic DNA (fetal heart) Chromatin input: 1% of the chromatin used for immunoprecipitation.

Abcam user community

Verified customer

Submitted Apr 20 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up