Overview

  • Product name

  • Description

    Rabbit polyclonal to PNGase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PNGase aa 327-538. BC007226.
    Sequence:

    ARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYV IAFSKDEVVDVTWRYSCKHEEVIARRTKVKEALLRDTINGLNKQRQLFLS ENRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLQR KETLFIPCENEKISKQLHLCYNIVKDRYVRVSNNNQTISGWENGVWKMES IFRKVETDWHMV


    Database link: Q96IV0

  • Positive control

    • WB: HeLa cell lysate. IHC-P: Human fetal stomach tissue.
  • General notes

    Protein previously known as NGLY1.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 74 kDa.

Target

  • Relevance

    NGLY1 is a highly conserved enzyme that catalyzes deglycosylation of misfolded N-linked glycoproteins by cleaving the glycan chain before the proteins are degraded by the proteasome (Zhou et al., 2006).
  • Cellular localization

    Cytoplasm
  • Database links

  • Alternative names

    • CDG1V antibody
    • hPNGase antibody
    • N glycanase 1 antibody
    • NGLY 1 antibody
    • Peptide N(4) (N acetyl beta glucosaminyl asparagine amidase antibody
    • Peptide:N glycanase antibody
    • PNG1 antibody
    • PNGase antibody
    see all

Images

  • Anti-PNGase antibody (ab197107) at 1/500 dilution + HeLa cell lysate

    Predicted band size: 74 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human fetal stomach tissue labeling PNGase with ab197107 at 1/100 dilution.

References

ab197107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up