Anti-PSF3 antibody (ab177515)
Key features and details
- Rabbit polyclonal to PSF3
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PSF3 antibody
See all PSF3 primary antibodies -
Description
Rabbit polyclonal to PSF3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Cat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human PSF3 aa 166-216. The exact sequence is proprietary. (NP_073607.2).
Sequence:ARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDME D
Database link: Q9BRX5 -
Positive control
- WB: 293T, HeLa and Jurkat whole cell lysates. IP: 293T cell lysate. IHC-P: Human breast carcinoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab177515 was affinity purified using an epitope specific to PSF3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab177515 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 24 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
|
IHC-P |
1/500 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 24 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
IHC-P
1/500 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA. -
Sequence similarities
Belongs to the GINS3/PSF3 family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 101088800 Cat
- Entrez Gene: 454133 Chimpanzee
- Entrez Gene: 101148415 Gorilla
- Entrez Gene: 64785 Human
- Entrez Gene: 100442718 Orangutan
- Entrez Gene: 707142 Rhesus monkey
- Omim: 610610 Human
- SwissProt: Q9BRX5 Human
see all -
Alternative names
- DNA replication complex GINS protein PSF3 antibody
- GINS complex subunit 3 antibody
- Gins3 antibody
see all
Images
-
All lanes : Anti-PSF3 antibody (ab177515) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 24 kDa
Exposure time: 3 minutes -
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast carcinoma tissue labeling PSF3 with ab177515 at a 1/1000 dilution.
-
Detection of PSF3 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab177515 at 6 µg/mg lysate for IP and at 0.1 µg/ml for subsequent western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 3 minutes.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab177515 has been referenced in 4 publications.
- McQuaid ME et al. Hypomorphic GINS3 variants alter DNA replication and cause Meier-Gorlin syndrome. JCI Insight 7:N/A (2022). PubMed: 35603789
- Bu F et al. Expression Profile of GINS Complex Predicts the Prognosis of Pancreatic Cancer Patients. Onco Targets Ther 13:11433-11444 (2020). PubMed: 33192076
- Li X et al. Nuclear PGK1 Alleviates ADP-Dependent Inhibition of CDC7 to Promote DNA Replication. Mol Cell 72:650-660.e8 (2018). PubMed: 30392930
- Moiseeva T et al. ATR kinase inhibition induces unscheduled origin firing through a Cdc7-dependent association between GINS and And-1. Nat Commun 8:1392 (2017). PubMed: 29123096