Overview

  • Product name

    Anti-PUS7L antibody - N-terminal
  • Description

    Rabbit polyclonal to PUS7L - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PUS7L aa 102-151 (N terminal). The exact sequence is proprietary. NP_112582.
    Sequence:

    QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK


    Database link: Q9H0K6

  • Positive control

    • HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 81 kDa.

Target

  • Relevance

    DKFZP434G1415 also called PUS7L, belongs to the pseudouridine synthase truD family and contains 1 TRUD domain. The most abundant modification seen in structured RNAs (transfer, ribosomal, and splicing RNAs) is the isomerization of uridine (U) to pseudouridine (5-ribosyluracil). Pseudouridine is made by a set of enzymes called pseudouridine synthase, which select specific U residues in a polynucleotide chain for isomerization to pseudouridine.
  • Database links

  • Alternative names

    • DKFZp781B2386 antibody
    • FLJ34711 antibody
    • FLJ40012 antibody
    • Pseudouridylate synthase 7 homolog antibody
    • Pseudouridylate synthase 7 homolog (S. cerevisiae)-like antibody
    • Pseudouridylate synthase 7 homolog-like protein antibody
    • PUS7L antibody
    see all

Images

  • Anti-PUS7L antibody - N-terminal (ab179996) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    Predicted band size: 81 kDa

References

ab179996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up