Overview

  • Product name

  • Description

    Rabbit polyclonal to PXR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human PXR aa 1-434.
    Sequence:

    MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG YHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLR KCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMM IRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWS QVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYM FKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFS PDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTEL RSINAQHTQRLLRIQDIHPFATPLMQELFGITGS


    Database link: O75469

Properties

Applications

Our Abpromise guarantee covers the use of ab192579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 50 kDa.

Target

  • Function

    Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
  • Tissue specificity

    Expressed in liver, colon and small intestine.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BXR antibody
    • Nr1i2 antibody
    • NR1I2_HUMAN antibody
    • Nuclear receptor subfamily 1 group I member 2 antibody
    • ONR 1 antibody
    • ONR1 antibody
    • Orphan nuclear receptor PAR 1 antibody
    • Orphan nuclear receptor PAR1 antibody
    • Orphan nuclear receptor PXR antibody
    • OTTHUMP00000215173 antibody
    • OTTHUMP00000215174 antibody
    • OTTHUMP00000215175 antibody
    • PAR 1 antibody
    • PAR 2 antibody
    • PAR antibody
    • PAR q antibody
    • PAR1 antibody
    • PAR2 antibody
    • PARq antibody
    • pregnane X nuclear receptor variant 2 antibody
    • Pregnane X receptor antibody
    • PRR antibody
    • PXR antibody
    • SAR antibody
    • Steroid and xenobiotic receptor antibody
    • SXR antibody
    see all

References

This product has been referenced in:

  • Yang L  et al. Panax ginseng Inhibits Metabolism of Diester Alkaloids by Downregulating CYP3A4 Enzyme Activity via the Pregnane X Receptor. Evid Based Complement Alternat Med 2019:3508658 (2019). Read more (PubMed: 31057647) »
  • Shubbar MH & Penny JI Effect of amyloid beta on ATP-binding cassette transporter expression and activity in porcine brain microvascular endothelial cells. Biochim Biophys Acta 1862:2314-2322 (2018). WB . Read more (PubMed: 30048740) »
See all 3 Publications for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Pig Cell (BRAIN)
Permeabilization
Yes - 0.3% Triton X-100
Specification
BRAIN
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Formaldehyde

Yu Siong Ho

Verified customer

Submitted Apr 24 2019

Application
Western blot
Sample
Pig Cell lysate - whole cell (Porcine brain endothelial cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
80 µg
Specification
Porcine brain endothelial cells
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Yu Siong Ho

Verified customer

Submitted Feb 22 2019

Abreviews
Application
Western blot
Sample
Rat Tissue lysate - whole (liver)
Gel Running Conditions
Non-reduced Non-Denaturing (Native) (10%)
Loading amount
15 µg
Specification
liver
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C

Abcam user community

Verified customer

Submitted Jan 08 2018

Abreviews
Application
ChIP
Sample
Bos taurus Cell lysate - nuclear (BFH12 (bovine foetal hepatocyte-like) cell line)
Negative control
Negative control: only Dynabeads (Invitrogen), without antibody. Negative control locus: bovine CYP3A28 (CYP3A4-like) coding sequence (exon 13).
Specification
BFH12 (bovine foetal hepatocyte-like) cell line
Detection step
Real-time PCR
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: formaldehyde 1%
Positive control
Positive control antibody: rabbit polyclonal to hystone H3 (AB1791-100). Positive control locus: not known cause of lacking information on PXR-mediated gene regulation in bovine. Promoter regions tested: 1. bovine CYP3A28 proximal promoter containing ER6 binding site, predicted to be specific for PXR 2. a distal region (about - 5000 bp from TSS), located in bovine CYP3A28 promoter, containing DR5 binding site, predicted to be specific for CAR

Abcam user community

Verified customer

Submitted Oct 31 2017

Application
Western blot
Sample
Bos taurus Tissue lysate - nuclear (liver)
Gel Running Conditions
Reduced Denaturing (12%)
Loading amount
30 µg
Specification
liver
Blocking step
Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 4°C

Prof. Mery Giantin

Verified customer

Submitted Oct 26 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up