Overview

  • Product name

  • Description

    Rabbit polyclonal to Protein C
  • Host species

    Rabbit
  • Specificity

    ab201089 detects endogenous levels of Protein C protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Synthetic peptide corresponding to Human Protein C aa 201-246.
    Sequence:

    TEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPS


    Database link: P04070

  • Positive control

    • HEK293T, Raw264.7, H9C2 and Hela whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201089 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity of is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 52 kDa.

Target

  • Function

    Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids (PubMed:25618265). Exerts a protective effect on the endothelial cell barrier function (PubMed:25651845).
  • Tissue specificity

    Plasma; synthesized in the liver.
  • Involvement in disease

    Thrombophilia due to protein C deficiency, autosomal dominant
    Thrombophilia due to protein C deficiency, autosomal recessive
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    The vitamin K-dependent, enzymatic carboxylation of some Glu residues allows the modified protein to bind calcium.
    N- and O-glycosylated. Partial (70%) N-glycosylation of Asn-371 with an atypical N-X-C site produces a higher molecular weight form referred to as alpha. The lower molecular weight form, not N-glycosylated at Asn-371, is beta. O-glycosylated with core 1 or possibly core 8 glycans.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
    May be phosphorylated on a Ser or Thr in a region (AA 25-30) of the propeptide.
  • Cellular localization

    Secreted. Golgi apparatus. Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activation peptide antibody
    • Anticoagulant protein C antibody
    • APC antibody
    • Autoprothrombin IIA antibody
    • Blood coagulation factor XIV antibody
    • EC 3.4.21.69 antibody
    • PC antibody
    • proC antibody
    • PROC_HUMAN antibody
    • PROC1 antibody
    • Protein C (inactivator of coagulation factors Va and VIIIa) antibody
    • THPH3 antibody
    • THPH4 antibody
    • Vitamin K dependent protein C antibody
    see all

Images

  • All lanes : Anti-Protein C antibody (ab201089)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate
    Lane 4 : Hela whole cell lysate

    Predicted band size: 52 kDa

References

This product has been referenced in:

  • Essalmani R  et al. Thrombin activation of protein C requires prior processing by a liver proprotein convertase. J Biol Chem 292:10564-10573 (2017). Read more (PubMed: 28468828) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up