
  • Product name
  • Description
    Rabbit polyclonal to QTRTD1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKF I) of Human QTRTD1 (NP_078914).

  • Positive control
    • Human fetal heart lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab82754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Interacts with QTRT1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
  • Pathway
    tRNA modification; tRNA-queuosine biosynthesis.
  • Sequence similarities
    Belongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily.
  • Cellular localization
    Cytoplasm. Mitochondrion. May associate with the mitochondrion outer membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ12960 antibody
    • QTRD1_HUMAN antibody
    • qtrtd1 antibody
    • queuine tRNA ribosyltransferase domain containing 1 antibody
    • Queuine tRNA-ribosyltransferase domain-containing protein 1 antibody
    • Queuine tRNA-ribosyltransferase subunit qtrtd1 antibody
    see all



ab82754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82754.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up