Anti-RAB43 antibody [5G4] (ab58030)
Key features and details
- Mouse monoclonal [5G4] to RAB43
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-RAB43 antibody [5G4] -
Description
Mouse monoclonal [5G4] to RAB43 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human RAB43 aa 113-211.
Sequence:IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETS AKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC
-
General notes
This product was changed from ascites to tissue culture supernatant on 11th June 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
5G4 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab58030 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration. Predicted molecular weight: 23 kDa.
|
|
IHC-P |
Use at an assay dependent concentration.
|
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 23 kDa. |
IHC-P
Use at an assay dependent concentration. |
Target
-
Tissue specificity
Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 339122 Human
- SwissProt: Q86YS6 Human
- Unigene: 381132 Human
- Unigene: 546542 Human
-
Alternative names
- RAB41 antibody
- RAB43 antibody
- RAB43_HUMAN antibody
see all
Images
-
RAB43 antibody (ab58030) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human salivary gland.
This image was generated using the ascites version of the product.
-
RAB43 antibody (ab58030) at 1ug/lane + HepG2 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
Datasheet download
References (4)
ab58030 has been referenced in 4 publications.
- Li Q et al. WTAP facilitates progression of endometrial cancer via CAV-1/NF-κB axis. Cell Biol Int 45:1269-1277 (2021). PubMed: 33559954
- Han MZ et al. High expression of RAB43 predicts poor prognosis and is associated with epithelial-mesenchymal transition in gliomas. Oncol Rep 37:903-912 (2017). PubMed: 28075478
- Rhee M et al. Preadipocyte factor 1 induces pancreatic ductal cell differentiation into insulin-producing cells. Sci Rep 6:23960 (2016). PubMed: 27044861
- Katsogiannou M et al. The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets. Mol Cell Proteomics 13:3585-601 (2014). WB . PubMed: 25277244