Overview

  • Product name

    Recombinant Dengue virus 2 NS1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Sequence

      DSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQPESPSKLASAIQKAH EEGI CGIRSVTRLENLMWKQITPELNHILSENEVKLTIMTGDIKGIMQAGKRSL RPQPTE LKYSWKTWGKAKMLSTESHNQTFLIDGPETAECPNTNRAWNSLEVEDYGF GVF TTNIWLKLKEKQDVFCDSKLMSAAIKDNRAVHADMGYWIESALNDTWKIE KAS FIEVKNCHWPKSHTLWSNGVLESEMIIPKNLAGPVSQHNYRPGYHTQITG PWH LGKLEMDFDFCDGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLP PLRY RGEDGCWYGMEIRPLKEKEENLVNSLVTAHHHHHH
    • Molecular weight

      40 kDa
    • Amino acids

      776 to 1127
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Strain: Thailand/16681/84

Specifications

Our Abpromise guarantee covers the use of ab181966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab181966 is 0.2µm filter sterilised.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

References

ab181966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The DENV NS1 protein products are all full length mammalian recombinants produced in a human cell line. They are hexameric in conformation as demonstrated by a single sharp peak at around 440kDa via SEC. They are correctly glycosylated due to the fact they are produced in human cells a band shift is seen when treated with endoglycosidases. The serotypes we used are as follows:



A leading Dengue research lab has confirmed they are reactive to dengue anti-sera (whereas NS1 produced in bacterial cells is not reactive).

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up