For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-hpv18-l1-protein-ab119881.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Organism Virus DNA Virus double stranded DNA Virus Human Papillomavirus
Share by email

Recombinant HPV18 L1 protein (ab119881)

  • Datasheet
Submit a review Q&A (5)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)
  • Western blot - Recombinant HPV18 L1 protein (ab119881)
  • Electron Microscopy - Recombinant HPV18 L1 protein (ab119881)
  • SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)

Key features and details

  • Expression system: Saccharomyces cerevisiae
  • Purity: > 90% SDS-PAGE
  • Suitable for: WB, SDS-PAGE, Electron Microscopy

You may also be interested in

Protein
Product image
Recombinant HPV16 L1 protein (ab119880)
Primary
Product image
Alexa Fluor® 647 Anti-GM130 antibody [EP892Y] - cis-Golgi Marker (ab195303)
Primary
Anti-HPV16 L1 antibody [CamVir 1] (ab69)

View more associated products

Description

  • Product name

    Recombinant HPV18 L1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab119881 is purified by ultracentifugation.
  • Expression system

    Saccharomyces cerevisiae
  • Accession

    AAQ92369.1
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MALWRPSDNTVYLPPPSVARVVNTDDYVTRTSIFYHAGSSRLLTVGNPYF RVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVW ACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVD YKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDM VDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCL RREQLFARHFWNRAGTMGDTVPQSLYIKGTGMRASPGSCVYSPSPSGSIV TSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTRSTNLTICASTQS PVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSIL EDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNV DLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKR VRVRARK
    • Predicted molecular weight

      57 kDa
    • Amino acids

      1 to 507

Specifications

Our Abpromise guarantee covers the use of ab119881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Electron Microscopy

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute in PBS

General Info

  • Alternative names

    • L1
    • HPV18 major capsid protein L1
    • Human papilloma virus type 18 major capsid protein L1
    • Human papillomavirus type 18 L1
    • Human papillomavirus type 18 major capsid protein L1
    • Major capsid protein L1
    see all
  • Relevance

    L1 is a major capsid protein of type 18 human papilloma virus. Infection with specific types of HPV has been associated with an increased risk of developing cervical neoplasia. HPV types 6 and 11 have been associated with relatively benign diseases such as genital warts but types 16 and 18 are strongly associated with cervical, vaginal, and vulvar malignancies.
  • Cellular localization

    Virion

Images

  • SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)
    SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)

    SDS-PAGE analysis of ab119881.

    Lane 1. ab119881
    Lane 2. MWt marker

  • Western blot - Recombinant HPV18 L1 protein (ab119881)
    Western blot - Recombinant HPV18 L1 protein (ab119881)
    Recombinant HPV18 L1 protein (ab119881)

    Predicted band size: 56.5 kDa



    Western blot analysis of ab119881.

    Lane 1. ab119881
    Lane 2. MWt marker

  • Electron Microscopy - Recombinant HPV18 L1 protein (ab119881)
    Electron Microscopy - Recombinant HPV18 L1 protein (ab119881)
    ab119881 viewed by electron microscopy.
  • SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)
    SDS-PAGE - Recombinant HPV18 L1 protein (ab119881)
    SDS-PAGE analysis of ab119881.

    Lane 1. ab119881, 3 µg/lane
    Lane 2. MWt marker 11.0, 17.0, 26.0, 34.0, 43.0, 55.0, 72.0, 95.0, 130.0, 170.0 kDa.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab119881? Please let us know so that we can cite the reference in this datasheet.

ab119881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-5 of 5 Abreviews or Q&A

Question

Hope this e-mail finds you well!
Please note that one of our customer recently purchased the antibodies viz. ab119881& ab31492 & is asking for below informations:


1 .Leaf let its mentioned reconstitute in PBS of HPV18L1 protein (ab119881), What concentration PBS is required?

2. HPV18L1 protein is mentioned molecularweight is 56.5kDa Please send me sample preparation of this protein for SDSPAGE method?

3.This is Virus like particle(VLP ) protein directly i could not get any band by SDSPAGE method .



Please send me sample preparation protocol for SDS-PAGE method . Weneed these details for optimization purpose.



Kindly advise us on the same.


Looking forward towards your valued response on it.

With Best Regards,

Read More

Abcam community

Verified customer

Asked on Feb 03 2012

Answer

Thank you for contacting us.

The protein can be reconstituted in 1X PBS.

No special protocol is needed for SDS-PAGE any general SDS-PAGE protocol will work. Please mix the protein with 1:1 loading buffer and boil for 5-10 minutes before loading into gel.

Try loading 5-10ug of protein.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Feb 03 2012

Question

What is the amino acid sequence of the HPV18 L1 protein?

Read More

Abcam community

Verified customer

Asked on Nov 27 2013

Answer

The sequence is the 507aa GenBank gb|AAQ92369 sequence.

http://www.ncbi.nlm.nih.gov/protein/AAQ92369.1

Read More

Tom Ruyle

Abcam Scientific Support

Answered on Nov 27 2013

Question

Thank you for your reply.

Customer received four vials of ab119881 & did not get the protein inside one vial after doing recommended reconstitution also.

Kindly arrange for further needful on it, since this is a very high potential regular user of our Abcam products.

Looking forward towards your valued reply on it.

With Best Regards,

Read More

Abcam community

Verified customer

Asked on Jul 23 2012

Answer

Thank you for providing that information.

I am sorry for the misunderstanding in this case. I am sorry to hear that the customer has not received the expected products in one of the vials. I would be happy to send a replacement to you if you would be able to provide me with the order number on which the 4 vials of ab119881 was ordered.

I have found4 separateorders of the following dates from you:



Are these the orders concerned?

Do you know which order the problem vial corresponds to?

If I arrange for a replacement vial of ab119881 to be sent could you please confirm the address I have for you is correct:
xxxxxxxxxxxxxxxxxxxx




Many thanks for your cooperation. I look forward to receiving your reply.

Read More

Abcam Scientific Support

Answered on Jul 23 2012

Question

Dear Sir,

Today we have received HPV18L1 lyophilized protein(ab119881)& Anti-HPV18L1 antibody(ab31492) from Abcam

I need to know,

1 .Leaf let its mentioned reconstitute in PBS of HPV18L1 protein What concentration PBS is required?

2. HPV18L1 protein is mentioned molecularweight is 56.5kDa Please send me sample preparation of this protein for SDSPAGE method?

3.This is Virus like particle(VLP ) protein directly i could not get any band by SDSPAGE method

Please send me sample preparation protocol for SDS-PAGE method . We have many VLP like 16,6,11 protein projects .

Once we will optimize this protein preparation feature we will purchse more antigens& Antibodys from Abcam

Awating for your reply.


With Regards,

Read More

Abcam community

Verified customer

Asked on Feb 07 2012

Answer

Thank you for your enquiry and your interest in our products.

Please find the information regarding ab119881 below:

Question 1.)

If you dissolve the HPV18L1 protein (50 micrograms) in 50 microliters of distilled water (the storage buffer is PBS) the concentration of HPV18L1 protein will be 1 mg/ml. If you need more diluted protein, please dilute it with PBS further.

Question 2.)

The theoretical molecular weight of HPV18L1 protein is 56.5kDa but the actual weight could be slightly different. For loading on SDS PAGE (minigel) you need to prepare the dissolved HPV18L1 protein (1mg/ml) as follows:

Prepare 90 microliters of Protein Sample or Loading Buffer x1 (you can prepare it yourself or purchase it ready-made) and add 10 microliters of the dissolved HPV18L1 protein (1mg/ml). Boil the mix 10 min and load on the gel 10 microliters per track of the cooled mix.

Question 3.)

If you prepare the HPV18L1 protein as explained above you will see 1 microgram per band on SDS PAGE after staining of the gel with Coomassie Blue.

I hope this helps and if I can assist further, please do not hesitate to contact me.

Read More

Abcam Scientific Support

Answered on Feb 07 2012

Question

Dear Technical Team,

Hope this e-mail finds you well!

Kindly look into the belowmail from one this customer & advise us on it, enabling us to update him accordingly.

Looking forward towards your valued reply/ comments on it.

Thankingyou in advance.

With Best Regards,

I spoke to you regarding HPV18L1 antigen we had received 4 vials
1 vial has not having antigen . Please find the following antigen details.

ab119881

lot number is GR72034-3

Kindly replace the material as soon as possible .

Regards,

Read More

Abcam community

Verified customer

Asked on Jul 20 2012

Answer

Thank you for contacting us.

I am sorry but I am a little unsure of what the customer has asked for. Has he found no product in the vial of ab119881 received?

The HPV18 L1 protein (ab119881) is the recombinantly expressed, full length HPV18 L1 protein which has been lypholised. The protein needs to be reconsituted prior to use, it is provided as a solid and may not be visible in the vial itself. But please be assured that 50 ug of protein is provided in each vial which can be reconsituted to the concentration of your choice using PBS.

I hope this information has been of help. If you have any further questions, please do not hesitate to ask.

Read More

Abcam Scientific Support

Answered on Jul 20 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.