Recombinant Human ABCA1 protein (ab125995)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human ABCA1 protein -
Purity
> 90 % SDS-PAGE.
Purified via His tag -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
NCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNR FGDGYTIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSL SSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLS LHKNQTVVDVA -
Amino acids
2085 to 2245
-
Specifications
Our Abpromise guarantee covers the use of ab125995 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.2% Guanidine HCl
-
ReconstitutionReconstitute with water to desired concentration.
General Info
-
Alternative names
- ABC 1
- ABC Transporter 1
- ABC-1
see all -
Function
cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport. -
Tissue specificity
Widely expressed, but most abundant in macrophages. -
Involvement in disease
Defects in ABCA1 are a cause of high density lipoprotein deficiency type 1 (HDLD1) [MIM:205400]; also known as analphalipoproteinemia or Tangier disease (TGD). HDLD1 is a recessive disorder characterized by absence of high density lipoprotein (HDL) cholesterol from plasma, accumulation of cholesteryl esters, premature coronary artery disease (CAD), hepatosplenomegaly, recurrent peripheral neuropathy and progressive muscle wasting and weakness.
Defects in ABCA1 are a cause of high density lipoprotein deficiency type 2 (HDLD2) [MIM:604091]; also known as familial hypoalphalipoproteinemia (FHA). HDLD2 is inherited as autosomal dominant trait. It is characterized by moderately low HDL cholesterol, predilection toward premature coronary artery disease (CAD) and a reduction in cellular cholesterol efflux. -
Sequence similarities
Belongs to the ABC transporter superfamily. ABCA family.
Contains 2 ABC transporter domains. -
Domain
Multifunctional polypeptide with two homologous halves, each containing an hydrophobic membrane-anchoring domain and an ATP binding cassette (ABC) domain. -
Post-translational
modificationsPhosphorylation on Ser-2054 regulates phospholipid efflux.
Palmitoylation by DHHC8 is essential for membrane localization. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab125995 has been referenced in 1 publication.
- Wang L et al. Novel interactomics approach identifies ABCA1 as direct target of evodiamine, which increases macrophage cholesterol efflux. Sci Rep 8:11061 (2018). PubMed: 30038271